Operator’s and Safety Manual
for Gasoline Power Cuts (page 2 - 27)
Manuel d’instructions et de sécurité
de découpeuse thermiques (page 28 - 53)
EK6100
EK6101
WARNING!
ReadandunderstandthisManual.AlwaysfollowsafetyprecautionsintheOperator’sandSafetyManual.Improperusecancauseseriousinjury! PreservethisManualcarefully!
WARNING!
FUELSWITHMORETHAN10%ETHANOLARENOTAPPROVEDFORUSEINMAKITA2-STROKEENGINES!
Useofalternativefuels,suchasE-20(20% ethanol),E-85(85% ethanol) oranyfuelsnotmeetingMAKITArequirementsarenotapprovedforuseinMAKITA2-strokegasolineengines!
USEOFALTERNATIVEFUELSCANCAUSETHEFOLLOWINGPROBLEMS:
Poorengineperformance,lossofpower,overheating,fuelvaporlock,improperclutchengagement,prematuredeteriorationoffuellines,prematuredeteriorationofgaskets,
prematuredeteriorationofcarburetors.
USINGALTERNATIVEFUELSAND/OR2-STROKEOILSNOTACCORDINGTOJASOFCORISO-L-EGDINMAKITA2-STROKEENGINESWILLVOIDYOURENGINEWARRANTY!
ATTENTION!
Suiveztoujourslesconseilsdesécuritéduprésentmanueld’emploietdesécurité.Uneutilisationincorrectedelatronçonneusepeutentraînerdesblessuresgraves!
Lisezetcomprenezcemanuel. Conservezavecsoincemanuel!
ATTENTION!
LESCARBURANTSCONTENANTPLUSDE10%D’ÉTHANOLNESONTPASAUTORISÉSPOURL’UTILISATIONDANSLESMOTEURS2TEMPS!
Lescarburantsalternatifs,telsqueE-20(20%d‘éthanol),E-85(85%d’éthanol)outoutautrecarburantn’étantpasconformesauxexigencesMAKITAnesontpasautorisés
pourl’utilisationdanslesmoteursessenceà2tempsMAKITA!
L’UTILISATIONDECARBURANTSALTERNATIFSPEUTCAUSERLESPROBLÈMESSUIVANTS:
Faibleperformancemoteur,Pertedepuissance,Surchauffe,Bouchonsdevapeurdanslaconduited’essence,Embrayageincorrect,Détériorationprématuréedesconduites
d’essence,Détériorationprématuréedesjointsd’étanchéité,Détériorationprématuréedescarburateurs.
L’UTILISATIONDECARBURANTSALTERNATIFSET/OUD’HUILES2TEMPSNON-CONFORMESÀLANORMEJASOFCOUISO-L-EGDDANSLESMOTEURSÀ2TEMPS
MAKITAANNULERAVOTREGARANTIEMOTEUR!
Thank you for purchasing a MAKITA product!
Congratulations on choosing a MAKITA Power Cut cutoff saw! Like our chain saws, the MAKITA Power Cuts feature specially designed high performance engines with outstanding power to weight ratios, for heavy duty yet lightweight tools.
Other advantages of the MAKITA Power Cuts:
•Sturdy construction and high reliability.
•Maintenance free electronic ignition, hermetically sealed to protect against dust and moisture.
•Vibration damping with the MAKITA2 mass system (D2M) for tireless working even when guiding the Power Cut by hand.
•Multilevelairfiltersystemwithturbo-cyclonefilterfordependa- ble function even under very dusty conditions.
•The Featherlight-Start system lets you start the cutter effortlessly with a spring-loaded starting assist.
•Extensive range of resin-bonded and diamond grit cutting discs.
We want you to be satisfied with your MAKITA product.
In order to guarantee the optimal function and performance of your Power Cut and to ensure your personal safety we would request you to perform the following:
Read this operator’s manual carefully before putting the Power Cut into operation for the first time, and strictly observe the safety regulations! Failure to observe these precautions can lead to severe injury or death!
WARNING 
The ignition system of this equipment produces an electro magnetic field. This field may interfere with some medical devices such as a pacemaker. To reduce the risk of serious or fatal injury, persons with a medical device should consult with their physician and the manufacturer of the device before operating this equipment.
Only for EK6100, EK6101: The Emissions Compliance Period referred to on the emission Compliance label indicates the number of operating hours for which the engine has been shown to meet federal emissions requirements.
Category C= 50 hours, B= 125 hours, and A= 300 hours.
Table of contents |
Page |
Packing ................................................................................ |
2 |
Delivery inventory ............................................................... |
3 |
Symbols ............................................................................... |
3 |
SAFETY PRECAUTIONS |
|
Intended use .................................................................... |
4 |
General precautions ........................................................ |
4 |
Protective equipment .................................................... |
4-5 |
Fuels / Refuelling ............................................................. |
5 |
Putting into operation ...................................................... |
5 |
Cutting discs .................................................................... |
6 |
Kickback and lock in ........................................................ |
7 |
Working behavior / Method of working ............................ |
7 |
Always observe the following when using |
|
synthetic resin cutting discs.............................................. |
8 |
Cutting metal ................................................................... |
8 |
Cutting masonry and concrete ..................................... |
8-9 |
Transport and storage ..................................................... |
9 |
Maintenance .................................................................. |
10 |
First aid .......................................................................... |
10 |
Disposal and environmental protection ......................... |
10 |
Technical data ................................................................... |
11 |
Denomination of components ......................................... |
12 |
PUTTING INTO OPERATION |
|
Mounting the cutting disc................................................ |
13 |
Fuels / Refuelling ...................................................... |
14-15 |
Starting the engine ........................................................ |
16 |
Cold-starting .................................................................. |
16 |
Warm-starting ................................................................ |
16 |
Stop engine ................................................................... |
16 |
Adjusting the carburetor .................................................. |
17 |
MAINTENANCE |
|
Changing the V belt ....................................................... |
18 |
Cleaning the protection hood ........................................ |
19 |
Cleaning / changing the air filter .................................... |
19 |
Replacing the spark plug ............................................... |
20 |
Checking the ignition spark............................................ |
20 |
Replacing the suction head ........................................... |
20 |
Replacing the starter cable ............................................ |
21 |
Replacing the return spring ........................................... |
22 |
Replacing the start spring .............................................. |
22 |
Instructions for periodic maintenance ............................ |
23 |
Replacing/cleaning the spark arrester screen................ |
23 |
Service, spare parts and guarantee ................................ |
24 |
Troubleshooting ................................................................ |
25 |
SPECIAL ACCESSORIES |
|
Diamond cutting discs, water tank.................................. |
25 |
Extract from spare parts list ....................................... |
26-27 |
2
Delivery inventory
5 |
4 |
3 |
2 |
1 |
1. Power Cut
2.Cutting disc (not in the general scope of delivery. Country-specific)
3.Screwdriver (for carburetor adjustment)
4.Offset screwdriver
5. Universal wrench 13/19
6. Operator’s and safety manual (not shown)
Symbols
You will notice the following symbols on the Power Cut and in the operator’s and safety manual:
Read operator’s and safety manual and follow the warningand safety precautions!
Particular care and caution!
Forbidden!
Never use circular saw blades!
Never use damaged cutting discs!
Wear helmet and eye, respiratory and hearing protection!
Wear protective gloves!
Wear respiratory protection!
Hazardous dust and/or gas emission!
Fire hazard from flying sparks!
No smoking!
No open fire!
Direction of cutting wheel rotation
Warning: the max. peripheral speed of the cutting disc is 80 m/s!
Cutting disc dimensions
Combination switch
Choke, On/Stop
Safety position
Start engine
Stop engine!
Warning!
Kickback!
Fuel and oil mixture
First aid
Recycling
Do not touch hot surfaces!
3
SAFETY PRECAUTIONS
Note: The illustrations in the safety precautions are not identical with the product!
Intended use
Power Cut
Use the Power Cut cutoff saw outdoors only, for trimming and cutting suitable materials, using cutting discs rated for this machine.
Improper use:
Never use the cutoff saw cutting discs for grinding or sanding (using the side of the cutting disc to remove material). The disc can break! Never use the Power Cut with saw blades, cutter blades, brushes, carbide tipped, wood cutting blades etc.
Unauthorised users:
Persons unfamiliar with the operator’s manual, children, young people, and persons under the influence of alcohol, drugs or med-
ications must not use the Power Cut.
General precautions
-The operator MUST read this operator’s manual to ensure safeoperation(evenifyoualreadyhaveexperienceinusing cutoff saws). It is important to be familiar with the operation of this particular cutoff saw. Users insufficiently informed will endanger themselves as well as others due to improper handling.
Let only persons who have experience in using cutoff saws work with this unit. When letting another person use the Power Cut, this operator’s manual must be provided along with it.
First time operators should ask a specialist to instruct them in working with gasoline powered cutoff saws.
Children and persons under 18 years of age must not be allowed to use this Power Cut. Persons over the age of 16 years may, however, use the Power Cut for the purpose of being trained as long as they are under the supervision of a qualified trainer.
Working with the Power Cut requires high concentration.
-Operate the Power Cut only if you are in good physical condition. If you are tired, your attention will be reduced. Be especially careful at the end of a working day. Perform all work calmly and carefully. The user has to accept liability for others.
-Never work while under the influence of alcohol, drugs, medication or other substances which may impair vision, dexterity or judgement.
-A fire extinguisher must be available in the immediate vicinity when working in easily inflammable vegetation or when it has not rained for a long time (danger of fire).
-Asbestos and other materials that can release toxins may be cut onlywiththenecessarysafetyprecautionsandafternotification of the proper authorities and under their supervision or that of a person appointed by them.
-The use of dust-reduction devices is urgently recommended (see Accessories, pressure water tank, water tank).
Protective equipment
-In order to avoid head, eye, hand or foot injuries as well as to protect your hearing the following protective equipment must be used during operation of the Power Cut: When using personal protective equipment, ensure compliance with ANSI Z87.1!
-The kind of clothing should be appropriate, i. e. it should be tight-fitting but not be a hindrance. Clothing in which grains of material can accumulate (trousers with cuffs, jackets and trousers with wide open pockets, etc.) must not be worn, particularly when cutting metal.
-Do not wear any jewellery or clothing that can get caught or distract from the operation of the Power Cut.
-It is necessary to wear a protective helmet whenever working with the Power Cut. The protectivehelmet(A) is to be checked in regular intervals for damage and is to be replaced after 5 years at the latest. Use only approved protective helmets.
-The helmet visor(B) protects the face from dust and material grains. In order to prevent injuries to eyes and face, always wear protectivegoggles(C) or visor when using the Power Cut.
-To prevent hearing damage, always wear suitable personal hearingprotection. (ear muffs (D), ear plugs, etc.). Octave brand analysis upon request.
-When dry cutting dust producing materials such as stone or concrete, always wear approved respiratoryprotection
(E).
-Work gloves (F) of tough leather are part of the required work kit of the Power Cut and must always be worn when working with the Power Cut.
1
2
3
4
4
-Always wear safetyshoesorboots(G) with steel toes, non skid soles, and leg protectors when working with the Power Cut. Safety shoes equipped with a protective layer provide protection against cuts and ensure a secure footing.
-Always wear a work suit (H) of tough material with sufficient flame-retardant qualities whenever working with the cutoff saw.
Fuels / Refuelling
-Go to a safe, level place before refuelling. Never refuel while on scaffolding, on heaps of material, or in similar places!
-Switch off the engine before refuelling the Power Cut.
-Do not smoke or work near open fires (6).
-Let the engine cool down before refuelling.
-Fuels can contain substances similar to solvents. Eyes and skin should not come in contact with mineral oil products.Always wear protective gloves when refuelling (not the regular work gloves!). Frequently clean and change protective clothes. Do not breathe in fuel vapors. Inhalation of fuel vapours can be hazardous to your health.
-Do not spill fuel. If a spill occurs, clean off the Power Cut immediately. Fuel should not come in contact with clothes. If your clothes have come in contact with fuel, change them at once.
-Ensure that no fuel oozes into the soil (environmental protection). Use an appropriate base.
-Refuelling is not allowed in closed rooms. Fuel vapors will accumulate near the floor (explosion hazard).
-Ensure to firmly tighten the screw cap of the fuel tank.
-Before starting the engine, move to a location at least 3 meters (approx. 10 feet) from where you fuelled the Power Cut (7), but not within the extended swing range of the cutting disc (direction of sparks).
-Fuel cannot be stored for an unlimited period of time. Buy only as much as will be consumed in the near future.
-When making up the gasoline/oil mixture, always put the oil in the mixing container first, and then the gasoline.
-Use only approved and marked containers for the transport and storage of fuel.
-Keep fuel away from children!
Putting into operation
-Do not work on your own. There must be someone around in case of an emergency (within shouting distance).
-Observe all anti noise regulations when working in residential areas.
-Never use the Power Cut near inflammable materials or explosive gases! The Power Cut can create sparks leading to fire or explosion!
-Make sure that all persons within 30 meters (100 feet), such as other workers, are wearing protective gear (see "Protective Equipment") (8). Children and other unauthorized persons must remain more than 30 meters away from the working area. Keep an eye out for animals as well (9).
-Before starting work the Power Cut must be checked for perfect function and operating safety according to the prescriptions. In particular, make sure that the cutting wheel is in good condition(replace immediately if torn, damaged or bent), the cutting wheel is properly mounted, the protective hood is locked in place, the hand guard is properly mounted, the V-belt has the proper tension, the throttle moves easily and the half-throttle lock button functions properly, the grips are clean and dry, and the combination switch functions properly (Start/Stop (I/O) switch, choke).Visuallyinspectthemufflerfordamageandpossibledirt in the muffler area.
-Start the Power Cut only after complete assembly and inspection. Never use the Power Cut when it is not completely assembled.
5
6 |
3 meters |
7 |
30 m
|
|
|
|
|
|
|
|
|
|
|
|
|
8 |
|
= wearing Protective Equipment |
||||||||||
|
||||||||||||
9
5
Cutoff discs
-The protection hood must always be on! Change discs only with the engine off!
-There are two basic types of cutoff discs:
-For metal (hot cutting)
-For masonry (cold cutting)
WARNING!
Neverusecarbidetipped,circularsawbladesoranykindofwood cutting blades. Never cut any type of wood. Reactive forces can cause severe personal injury from blade contact or thrown tips.
NOTE:When using diamond cutoff discs, always make sure to observe the "direction of rotation" markings. Diamond discs should only be used for cutting masonry/brick/ concrete etc.
-Cutoff discs are intended only for radial loading, i.e. for cutting. Do not grind with the sides of the cutting disc! This will break the disc (10)!
Caution!
Never change direction (turning radius less than 5 meters (16 feet),exertlateral(sideways)pressure,ortipthePowerCutduring cutting (11)!
-Use a cutting disc only for cutting the materials it is intended for. The proper type of disc must be used, for either metals or masonry.
-Thearborholeofthecuttingdiscmustbeanexactfitwiththearbor or shaft. If the arbor hole is larger, it must be fitted with an adapter ring (available as an accessory).
-The cutting disc must be rated for freehand cutting at up to 4370 rpm or 80 m/sec for 350 mm discs, or up to 5100 rpm or 80 m/s for 300 mm discs. Use only cutting discs that comply with EN 12413, EN 13236.
-The disc must be free of defects (12). Do not use defective cutting discs.
Always tighten the cutting disc mounting bolt to a torque of 30 Nm. Otherwise, the cutting disc can twist.
-Beforestartingthecuttingdisc,makesureyouhaveasteadyfooting.
-Put the Power Cut into operation only as described in this operator’s manual (13). Always place your left foot in the rear handle and grasp the other handle firmly (with thumb and fingers). Other starting methods are not allowed.
-When starting the Power Cut it must be well supported and securely held. The cutting disc must not be touching anything.
-If the cutting disc is new, test it by running it at least 60 seconds at topspeed.Whendoingthis,makesurethatnopersonsorbodyparts are in the extended swing range of the disc, in case it is defective and flies apart.
-When working with the Power Cut always hold it with both hands. Take the back handle with the right hand and the tubular handle with the left hand. Hold the handles tightly with your thumbs facing your fingers.
-CAUTION: When you release the throttle lever the disc will keep spinning for a short period of time (free wheeling effect).
-Continuously ensure that you have a safe footing.
-Hold the Power Cut such that you will not breathe in the
exhaust gas. Do not work in closed rooms or in deep holes or ditches (danger of poisoning by fumes).
-WARNING – CARBON MONOXIDE PRODUCED DURING USE CANKILL–DONOTUSEPOWERCUTTERINDOORS–MAKE SURETHEREISPROPERVENTILATIONWHENUSINGPOWER CUTTER IN TRENCHES OR OTHER CONFINED SPACES.
-Switch off the Power Cut immediately if you observe any changes in its operating behavior.
-Switch off the engine before inspecting the V-belt tension or tightening it, replacing the cutting wheel or eliminating faults
(14).
-Turn off the engine immediately and check the disc if you hear or feel any change in cutting behaviour.
-Turn off the Power Cut when taking a break or stopping work (14). Place the unit in such a way that the disc is not touching anything and cannot endanger anyone.
-DonotputtheoverheatedPowerCutindrygrassoronanyinflammable objects. The muffler is very hot (danger of fire).
-IMPORTANT:Afterwetcutting,firstturnoffthewaterfeedandthen let the disc run at least 30 seconds, to fling off the remaining water and prevent corrosion.
6
10 |
min. 5 m
11
12 |
13 |
● Refuelling
● Changing cutoff discs ● Stopping work
● Transport
● Putting out of function ● Maintenance
14
Kickback, lock in and gyroscopic forces
-When working with the Power Cut there is a danger of kickback and lock in.
-Kickback occurs when the top of the cutting disc is used for cutting (15).
-This causes the Power Cut to be thrown back toward the user with great force and out of control. Risk of injury!
To prevent kickback, observe the following:
-Never cut with the section of the cutting disc shown in figure 15.
Be especially careful when reinserting the disc into cuts that have already been started!
-Lock in occurs when the cut narrows (crack, or workpiece under stress).
-This causes the Power Cut to suddenly jump forward, out of control and with great force. Risk of injury!
To prevent lock in, observe the following:
-When reinserting the disc into previous cuts, have the Power Cut running at top speed. Always cut at top speed.
-Always support the workpiece so that the cut is under tension (16), so that the cut does not press together and jam the cutting disc as it proceeds through the material.
-When starting a cut, apply the disc to the workpiece with care. Do not just shove it into the material.
-Never cut more than one piece at a time! When cutting, make sure that no other workpiece comes into contact.
-Gyroscopic forces come into play when handling a power cutter with a rapidly rotating composite wheel.
-The power cut will react in an uncontrolled manner. There is a danger that injuries may occur.
In order to prevent gyroscopic forces developing, please note the following: Do not rotate the machine rapidly about its longitudinal axis!
Working behavior / Method of working
-Check the integrity of the composite wheel both before and after fitting it to the machine.
-Before starting work, check the work area for any hazards
(electrical wires, inflammable substances). Clearly mark the work area (for example with warning signs or by cordoning off the area).
-WhenworkingwiththePowerCutholditfirmlybythefrontand rear handles. Never leave the Power Cut unattended!
-Use the Power Cut at high speed as far as possible (see “Technical Data”).
-Only use the Power Cut during good light and visibility periods. Be aware of slippery or wet areas, and of ice and snow (risk of slipping).
-Never work on unstable surfaces. Make sure that there are no obstacles in the working area, risk of stumbling. Always ensure that you have a safe footing.
-Never cut above your shoulder height (17).
-Never stand on a ladder to cut (17).
-Never use the Power Cut while standing on scaffolding.
-Do not lean over too far when working. When putting down and picking up the Power Cut, do not bend over from the waist, but instead bend in the knees. Save your back!
-Guide the Power Cut in such a way that no part of your body is within the extended swing range of the disc (18).
-Use cutting discs only for the materials for which they are designed!
-Use cutting discs only for the materials for which they are designed. Do not use the Power Cut to lift up and shovel away pieces of material and other objects.
Important! Before cutting, remove all foreign objects, such as rocks, gravel, nails etc. from the cutting area. Otherwise, such objects can be flung away by the disc with great speed. Injury hazard!
-When cutting workpieces down to length use a firm support.
If necessary, secure the workpiece from slipping, but do not steady it with your foot or allow another person to hold it.
-When cutting round items, always secure them against rotation.
15
16 |
17 |
18
7
When using synthetic resin cutting discs, always observe the following:
CAUTION:
-Synthetic resin cutting discs can absorb moisture. This moisture can cause the disc to become unbalanced at high speed. This imbalance can cause the disc to break.
-Do not cool resin cutting discs with water or other fluids.
-Do not expose resin cutting discs to high humidity or rain!
Do not use resin cutting discs past their use-by date (expiration date)! The date (quarter and year) is stamped on the disc’s arbor ring.
EXAMPLE: 04 / 2018
This cutting disc can be used through the end of the fourth quarter of 2018, if properly stored and correctly used.
Cutting metals
IMPORTANT!
Always wear approved respiratory protection!
Materials that can release toxic substances may be cut only after notifying the proper authorities and under their supervision or that of a person appointed by them.
CAUTION!
Therapidrotationofthecuttingdischeatsmetalandmeltsitat the point of contact. Swing the guard as far down as possible (19) inordertodirectthestreamofsparksforward,awayfrom the operator (fire hazard).
-Determine the cut line, mark the cut and apply the disc to the material at moderate speed, to cut a guide groove before going to top speed and applying more pressure to the Power Cut.
-Keep the disc straight and vertical. Do not tip it, as this can break it.
-The best way to get a good, clean cut is to pull or move the Power Cut back and forth. Do not simply press the disc into the material.
-Thick round stock is best cut in stages (20).
-Thin tubing and pipes can be cut with a simple downward cut.
-Cut large diameter pipes as for round stock. To prevent tipping and for better control, do not let the disc sink too deeply into the material. Instead, always cut shallow around the whole piece.
-Worn discs have a smaller diameter than new discs, so that at the same engine speed they have a lower effective circumferential speed and therefore do not cut as well.
-Cut I beams and L bars in steps; see Figure 21.
-Cut bands and plates like pipes: along the wide side with a long cut.
-When cutting material under stress (supported material or material in structures), always make a notch in the thrust (pressure) side, and then cut from the tension side, so that the disc does not lock in. Secure cutoff material from falling!
CAUTION!
If there is a chance that the material is under stress, be prepared for it to kick back. Make sure you can get out of the way if you have to!
Beparticularlycarefulinscrap metalyards,junkyards,ataccident sites, and with haphazard piles of material. Precariously balancedpiecesorpiecesunderstresscanactinunpredictable ways,andmayslide,jumpout,orburst.Securecutoffmaterial from falling! Always exercise extreme caution and use only equipment that is in perfect working order.
Observetheaccident preventionrulesandregulationsofyour employer and/or insurance organization.
Cutting masonry and concrete
IMPORTANT!
Always wear approved respiratory protection!
Asbestos and other materials that can release toxic substancesmaybecutonlyafternotifyingtheproperauthorities and under their supervision or that of a person appointed bythem.Whencuttingprestressedandreinforcedconcrete piles, follow the instructions and standards of the responsible authorities or the builder of the structural member. Reinforcementrodsmustbecutintheprescribedsequence and in accordance with applicable safety regulations.
NOTE:
Mortar,stone,andconcretedeveloplargequantitiesofdustduring cutting. To increase the lifetime of the cutting disc (by cooling), to improve visibility, and to avoid excessive dust creation, we strongly recommend wet cutting instead of dry cutting.
19 |
20
21
8
In wet cutting, the disc is wetted at an equal rate on both sides by a trickle of water. MAKITA offers the right accessories for all wet cutting applications (see also "SPECIAL ACCESSORIES").
-Remove foreign objects such as sand, stones and nails found within the working area. Caution:Watchoutforelectricwires and cables!
The rapid rotation of the cutting disc at the point of contact throws fragments out of the cut groove at high speed. For your safety, swing the protection hood down as far as possible(23),sothatmaterialfragmentsarethrownforward,away from the operator.
-Mark the cut, and then make a groove about 5 mm (just under 1/5") along the entire length of the planned cut. This groove will then guide the Power Cut accurately guring the actual cutoff.
-Perform the cut with a steady back and forth motion.
-When cutting slabs to size, you need not cut through the entire material thickness (creating unnecessary dust). Instead, simply make a shallow groove, and then knock off the excess material cleanly on a flat surface (25).
CAREFUL!
When cutting into lengths, cutting through material, making cutouts, etc., always make sure to plan the direction and sequence of cuts in such a way that the disc does not get jammed by the cut off piece, and that no persons can be injured by falling pieces.
Transport and storage
-Always turn off the Power Cut when transporting it or moving it from place to place on a site (26).
-Never carry or move the unit with the engine on or the disc moving!
-Carry the unit only by the tubular (middle) handle with the cutting disc pointing behind you (26). Avoid touching the exhaust muffler (burn hazard!)
-When moving the Power Cut over longer distances, use a wheelbarrow or wagon.
-When transporting the Power Cut in a vehicle, make sure it is securely positioned in such a way that no fuel can leak out. Always remove the cutting disc before transporting the unit in a vehicle.
-The Power Cut should be stored safely in a dry place. It must not be left outdoors! Always dismount the cutting disc before storage. Keep the Power Cut away from children.
-Before long term storage and before shipping the Power Cut, follow the instructions in the chapter on "Periodic care and maintenance".ALWAYS empty the fuel tank and run the carburetor dry.
-When putting cutting discs in storage, be careful to:
•Clean and dry them well. CAUTION:Do NOTclean synthetic resin cutting discs with water or other fluids!
•Store them lying down flat.
•Avoid dampness, freezing temperatures, direct sunshine, high temperatures and temperature fluctuations, as these can cause breakage and splintering.
•Before re-using a resin cutting disc, make sure of the use-by (expiration)date(quarterandyear,stampedonthearborring). If this date has been exceeded, do NOTuse the cutting disc.
-Alwayschecknewcuttingdiscsorcuttingdiscsthathave been in storage to make sure that they are free of defects and before the first cut test-run the tool at top speed for at least 60 seconds. Keep body parts and people well away out of range of the direction of the cutting disc during this test.
23 |
25
26
9
Maintenance
-Beforeperformingmaintenanceworkswitchoffthe Power Cut (27) and pull out the plug cap.
-Allow the Power Cut to cool off before doing any maintenance work (burn hazard)!
-Always check the Power Cut before using it to make sure that it is in good working order. In particular, make sure that the cutting disc is properly mounted. Make sure that the cutting wheel is undamaged and suitable for the job it will be used for.
-Operate the Power Cut only at a low noise and emission level. For this ensure the carburetor is adjusted correctly.
-Clean the Power Cut regularly.
-Check the fuel tank cap regularly for good sealing.
Observe the accident prevention instructions issued by trade associations and insurance companies. NEVER make any modifications to the Power Cut! You will only be putting your own safety at risk!
Perform only the maintenance and repair works described in the operator’s manual. All other work must be carried out by
MAKITA Service.
Use only original MAKITA spares and accessories.
The use of non MAKITA spares, accessories, or cutting discs increases the risk of accident. We cannot accept any responsibility for accidents or damage occurring in association with the use of cutting discs or accessories other than original MAKITA.
First aid
For the event of a possible accident, please make sure that a firstaidkitisalwaysimmediatelyavailablecloseby.Immediately replace any items used from the first aid box.
When calling for help, give the following information:
-Place of the accident
-What happened
-Number of injured people
-Kind of injuries
-Your name!
NOTE
Individuals with poor circulation who are exposed to excessive vibration may experience injury to blood vessels or the nervous system.
Vibration may cause the following symptoms to occur in the fingers, hands or wrists: ”Falling asleep” (numbness), tingling, pain,
stabbing sensation, alteration of skin colour or of the skin. If any of these symptoms occur, see a physician!
Disposal and environmental protection
Be mindful of the environment!
Dispose of worn-out or defective cutting discs in accordance with your local disposal regulations. To protect unusable cutting discs from misuse, destroy them before disposal.
When the Power Cut is worn out or damaged beyond repair, have it disposed of or recycled in an environmentally sound manner. If necessary, consult your local authorities.
27
28
29
SERVICE
10
Technical data |
|
|
|
|
||
|
EK6100 |
|
EK6101 |
|||
|
|
|
|
|
||
|
|
|
|
|
|
|
|
|
Displacement |
cu in (cm3) |
3.7 (60.7) |
|
3.7 (60.7) |
|
|
Bore |
in (mm) |
1.85 (47) |
|
1.85 (47) |
|
|
Stroke |
in (mm) |
1.38 (35) |
|
1.38 (35) |
|
|
Max. power / operating speed |
hp (kW)/1/min |
4.4 (3.2) / 9.500 |
|
4.4 (3.2) / 9.500 |
|
|
Max. torque |
Nm |
3.9 |
|
3.9 |
|
|
Idling speed |
1/min |
2.600 |
|
2.600 |
|
|
Clutch engagement speed |
1/min |
3.900 |
|
3.900 |
|
|
Engine speed limitation |
1/min |
9.850 ± 150 |
|
9.850 ± 150 |
|
|
Max. spindle speed |
1/min |
5.100 |
|
4.400 |
|
|
Sound pressure level at the operators ear |
dB(A) |
100 |
|
100 |
|
|
Sound pressure level at the bystander’s position (50 ft) |
dB(A) |
79 |
|
80 |
|
|
Vibration acceleration ah,w per ANSI.175.4 |
m/s2 |
5.6 |
|
5.6 |
|
|
- Tubular handle (rated speed) |
|
|||
|
|
- Rear handle (rated speed) |
m/s2 |
5.1 |
|
5.1 |
|
|
Carburetor (diaphragm carburetor) |
Type |
|
ZAMA |
|
|
|
Ignition system (with speed limitation) |
Type |
|
electronic |
|
|
|
Spark plug |
Type |
NGK BPMR 7A |
||
|
|
Electrode gap |
in (mm) |
.020 (0.5) |
|
.020 (0.5) |
|
|
Fuel consumption at max. load per ISO 8893 |
kg/h |
1.42 |
|
1.42 |
|
|
Specific consumption at max. load per ISO 8893 |
g/kWh |
430 |
|
430 |
|
|
Fuel tank capacity |
fl oz (l) |
23.6 (0.7) |
|
23.6 (0.7) |
|
|
Mixture ratio (fuel/two-stroke oil) |
|
50:1 |
|
50:1 |
|
|
- when using MAKITA Synthetic oil |
|
|
||
|
|
- when using other synthetic oil (quality grade: JASO FC or ISO EGD) |
50:1 |
|
50:1 |
|
|
|
Cutting disc for 80 m/sec. 1) |
in |
12" / 0.8" / 0.2" 2) |
|
14" / 0.8" / 0.2" 2) |
|
|
Cutting disc for 80 m/sec. 1) 3) |
in |
-- |
|
14" / 1" / 0.2" 2) |
|
|
Arbor diameter |
in |
0.8" |
|
0.8" |
|
|
Overall weight (tanks empty, without cutting disc) |
lb (kg) |
18.7 (8,5) |
|
19.6 (8,9) |
1)Circumference speed at max. engine speed.
2)Outside diameter / arbor hole / maximum permissible thickness of the composite wheels.
3)Country-specific.
11
Denomination of components
1 |
Handle |
14 |
Air intake |
2 |
Air filter cover |
15 |
Fuel pump (Primer) |
3 |
Tubular handle |
16 |
Safety locking button |
4 |
Protection hood |
17 |
Throttle lever |
5 |
Water set |
18 |
Combination switch „Choke, On/Stop (I/O)” |
6 |
Adjusting screw |
19 |
Fuel tank fill-level window |
7 |
Hold opening |
20 |
Starter housing with starter |
8 |
Fuel tank with handle |
21 |
Stand |
9 |
Identification plate |
22 |
Muffler |
10 |
Tank cap (fuel) |
23 |
Cutting disc |
11 |
Carburetor adjustment opening |
24 |
Disc bolt |
12 |
Holder for combination tool and 1/2" hose |
25 |
Spring washer |
13 |
Starter grip |
|
|
12
PUTTING INTO OPERATION
CAUTION:
Always turn off the engine and pull off the spark plug cap before doing any work on the Power Cut! Always wear protective gloves!
CAUTION:
Start the Power Cut only after complete assembly and inspection.
For the the following work, use the assembly tools included with delivery:
1.13/19 AF combination wrench
2.Allen key
3.Carburetor adjustment screwdriver
Place the Power Cut on a stable surface and carry out the following assembly steps:
Sequence |
Mounting the cutting disc
Checktheintegrityofthecompositewheelboth before and after fitting it to the machine.
See SAFETY INSTRUCTIONS, Page 6.
Unscrew screw (9) and remove the spring washer (8). Place the cutting disc (5) on the arbour (7).
NOTE:
The arbor hole of the cutting disc must be an exact fit with the arbor or shaft. Ensure that the composite wheel is seated correctly!
For cutoff discs with 25.4 mm (1”) arbor holes, use the cor-
rect size disc holder (supplied only with cutoff discs with 25.4 mm (1”) arbor holes). Non-compliance can cause serious injury!
11
10
2 |
8
1 |
Makesurethecuttingdiscisinstalledsoitturnsintheright direction, if a direction is marked on the disc.
Place the spring washer (8) on the arbour and insert the screw (9) and tighten by hand.
Slowly turn the cutoff disc until a hole (11) in the V-belt pulley is visible in the counter-holding opening (10) of the cutting arm.
Insert theAllen key (2) as far as it will go.The shaft is now blocked. Tighten the screw with the combination wrench (1).
NOTE: Tighten the screw firmly (30 ± 2 Nm), as otherwise the cutting wheel may slip during cutting.
Remove the Allen key and combination tool.
13
Fuels
Caution:
This tool uses petroleum products (gasoline and oil).
Be especially careful when handling gasoline.
Do not smoke. Do not allow gasoline to come near flames, sparks or fire (explosion hazard).
Fuel mixture
This tool is powered by a high performance air-cooled two stroke engine. It runs on a mixture of gasoline and two-stroke engine oil.
The engine is designed for unleaded regular gasoline with a min. octane value of 89 (R+M)/2. In case no such fuel is available, you can use fuel with a higher octane value. This will not affect the engine.
Inordertoobtainanoptimumengineoutputandtoprotect your health and the environment use unleaded fuel only.
To lubricate the engine, use a synthetic oil for two-stroke air-coo- led engines (quality grade JASO FC or ISO-L-EGD), which has to be added to the fuel.
The correct mixture ratio:
50:1 When using MAKITA synthetic two-stroke engine oil, i. e. 50 parts gasoline to 1 part oil.
50:1 When using other synthetic two-stroke engine oil (quality grade JASO FC or ISO -L -EGD), i. e. 50 parts gasoline to 1 part oil.
MAKITA synthetic two-stroke engine oil (50:1) is available in the following sizes to suit your individual requirements:
2.6 floz. order number T-00745
6.4 floz. order number T-00739
NOTE: For preparing the fuel-oil mixture first mix the entire oil quantity with half of the fuel required, then add the remaining fuel.
Thoroughly shake the mixture before filling it into the tank.
Caution: Open the tank cap carefully, as pressure might have built up inside!
It is not wise to add more engine oil than specified to ensure safe operation. This will only result in a higher production of combustionresidueswhichwillpollutetheenvironmentand clogtheexhaustchannelinthecylinderaswellasthemuffler. In addition, fuel consumption will rise and performance will decrease.
Gasoline 50:1
+OIL
50:1
1.0 |
Us-gal. |
(3.7 l) |
2.6 floz. |
(75 cm3) |
2.5 |
Us-gal. |
(9.4 l) |
6.4 floz. |
(189 cm3) |
5.0 |
Us-gal. (18.9 l) |
12.8 floz. |
(378 cm3) |
|
The Storage of Fuel
Fuels have a limited storage life. Fuel and fuel mixtures age through evaporation, especially at high temperatures. Aged fuel and fuel mixtures can cause starting problems and damage the engine.
Purchase only that amount of fuel, which will be consumed over the next few months. At high temperatures, once fuel has been mixed it should be used up in 6-8 weeks.
Store fuel only in proper containers, in dry, cool, secure locations!
AVOID SKIN AND EYE CONTACT
Mineral oil products degrease your skin. If your skin comes in contact with these substances repeatedly and for an extended period of time, it will desiccate. Various skin deseases may result. In addition, allergic reactions are known to occur.
Eyes can be irritated by contact with oil. If oil comes into your eyes, immediately wash them with clear water. If your eyes are still irritated, see a doctor immediately!
14
Refuelling
IMPORTANT:
FOLLOW THE SAFETY PRECAUTIONS!
Be careful and cautious when handling fuels. The engine must be turned off and cooled down!
Carefully clean the area around the fuel tank filler neck to keep dirt from getting in the tank.
Place the Power Cut on an even surface.
Unscrew the tank cap and fill tank with fuel mixture. Take care to avoid spilling.
Screw the tank cap back on hand-tight.
Clean screw cap and tank after refuelling. Never start or operate the Power Cut in the same place as it was fuelled!
If fuel gets on your clothing, change clothes immediately.
Fuel mixture
Starting the engine
if
necessary
3 meters
CAUTION:
Observe the SAFETY INSTRUCTIONS on page 5 and 6!
Start the Power Cut only after complete assembly and inspection!
Move at least 3m (10 feet) away from the place where you fuelled the Power Cut.
Make sure you have a good footing, and place the Power Cut on the ground in such a way that the cutting disc is not touching anything.
15
|
2 |
Move the protective hood (1) into the proper position for the |
|
|
|
2a |
1 |
work you intend to do (see illustration). |
The protective hood (1) can be moved between the stops in |
||
|
|
both directions. |
Note: A water supply line (from a pressurized water tank or other source) is connected by the water set on the protective hood. The water flow rate can be adjusted with the adjusting screw (2). Press the 1/2" hose into the holder (2a).
For a slower flow, turn the adjusting screw clockwise.
For a faster flow, turn it counter-clockwise.
4
3
5
6
Cold start (Choke)
Warm start (ON)
Engine off
Combination switch in safety position
(ignition current cut off, necessary for all maintenance, repair, and installation work)
Cold starting:
Grasp front handle firmly with one hand and press the Power
Cut against the ground.
Place left toe in the rear handguard.
Prime the fuel pump (4) by pressing it several times until you can see fuel in the pump.
Move the combination switch (3) up (choke position). This also actuates the half-throttle lock.
Pull starter handle smoothly and evenly, until you hear the first ignition (but max. 3-5 pulls).
CAUTION: Do not pull the starter cable more than about 50 cm/20” out, and let it back in slowly by hand.
Move the combination switch (3) to the central “ON” position. Pull the starter handle smoothly and evenly again.
As soon as the engine is running, grasp the rear handle (the safety lock button (5) is actuated by the palm of the hand) and press the throttle trigger (6). The half-throttle lock will disengage and the engine will now idle.
Warmstart:
As described above for cold starting, but before starting push the combination switch (3) up (Choke position) and
then right away back to the middle “ON” position. This is only to engage the half-throttle lock. If the engine doesn’t start after
2 or 3 pulls, repeat the entire starting procedure as described for cold starting.
NOTE: If the engine was switched off only for a short time, the saw can be started without using the combination switch.
Important:If the fuel tank has been completely emptied and the engine has stopped due to lack of fuel prime the fuel pump (4) by pressing it several times until you can see fuel in the pump.
Stopping the engine
Depress the combination switch 
(3).
NOTE: After being pressed down, the combination switch will revert to the ”ON” position again. The engine is switched off, but can be turned on again without moving the combination switch.
IMPORTANT: To cut off the ignition current, push the combination switch all the way down past the resistance point to the safety position ( 
).
16
Adjusting the carburetor
NOTE: The grinding parts are equipped with an electronic ignition to limit the speed.
At the factory the idling speed has been set to approx. 2600rpm,buttherunning-inprocessofanewenginemay require slight readjustment of the idling speed.
Adjustments to the adjusting screws (L) and (H) may only be made by an authorised MAKITA service center.
SERVICE
7
For correct adjustment of the idling speed the following steps must be carried out:
T |
Starttheengineandrunituntilitiswarm(about 3 - 5 minutes). |
Adjust the carburetor with the screwdriver (7) included with the
Power Cut. It has a lug that helps with adjustment.
Readjust the idling speed.
If the cutoff disc turns when the engine is idling, turn the throttle stop screw (T) counter-clockwise in small increments until the disc no longer turns.
If the engine suddenly stops in idle, turn the screw back slightly clockwise.
Switch off the engine. 
MAINTENANCE
CAUTION:
BeforedoinganyworkonthePowerCutturnofftheengine, removethecuttingdisc,pulltheplugcapoffthesparkplug and wear protective gloves!
CAUTION:
Start the Power Cut only after complete assembly and inspection.
17
Loading...