ETi® 400 HIGH EFFICIENCY HEATER
INSTALLATION AND USER’S GUIDE
FOR YOUR SAFETY - READ BEFORE OPERATING
If you do not follow these instructions exactly, a fire or explosion may result, causing property damage, personal injury or loss of life. For additional free copies of this manual; call USA (800) 831-7133
FOR YOUR SAFETY - This product must be installed and serviced by authorized personnel, qualified in pool/spa heater installation. Improper installation and/or operation can create carbon monoxide gas, fire or explosion, and flue gases which can cause serious injury, property damage, or death. For indoor installations, as an additional measure of safety, Pentair Water Pool and Spa, Inc. strongly recommends installation of suitable Carbon Monoxide detectors in the vicinity of this appliance and in any adjacent occupied spaces. Improper installation and/or operation will void the warranty.
Improper installation, adjustment, alteration, service or maintenance can cause property damage, personalinjuryordeath.Installationandservicemust be performed by a qualified installer, service agency or the gas supplier.
120 / 240 VAC NATURAL GAS / LP GAS
Model |
Natural |
ETi® 400 NA - ASME |
461113 |
OWNER:
Retain For
Future
Reference
FOR
YOUR
SAFETY
WHAT TO DO IF YOU SMELL GAS
•Do not try to light any appliance.
•Do not touch any electrical switch; do not use any phone in your building.
•Immediately call your gas supplier from a neighbor’s phone. Follow the gas supplier’s instructions.
•If you cannot reach your gas supplier, call the fire department.
DONOTstoreorusegasolineorotherflammablevaporsandliquidsinthevicinity of this or other appliances.
Pentair Water Pool and Spa, Inc.
1620 Hawkins Ave., Sanford, NC 27330 • (800) 831-7133 or (919) 566-8000 10951 W. Los Angeles Ave., Moorpark, CA 93021 • (800) 831-7133 or (805) 553-5000
Customer2 Service and Technical Support
Customer Service and Technical Support
If you have questions about ordering Pentair Water Pool and Spa, Inc. replacement parts, and pool products, please call:
Phone: (800) 831-7133
Fax: (800) 284-4151
(8 AM to 7:30 PM Eastern Time/Pacific Time)
Web sites: www.pentair.com
P/N 475349 Revision E. 3/2020
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
Rev. E 3/2020 |
|
Contents 3 |
Contents |
|
Warning and Safety Information ................................................................................ |
5 |
Important Notices............................................................................................................................................ |
5 |
Heater Application Information........................................................................................................................ |
5 |
Code Requirements........................................................................................................................................ |
6 |
Consumer Information and Safety Information............................................................................................... |
6-8 |
General Specifications.................................................................................................................................... |
9 |
Heater Identification Information ............................................................................... |
9 |
Section 1. Operation Instructions.............................................................................. |
10 |
Operator Control Panel................................................................................................................................... |
10-11 |
Basic System Operation.................................................................................................................................. |
11 |
Heater DSI Electronic Ignition Lighting/Operation....................................................................................... |
11 |
Start-Up Operation ..................................................................................................................................... |
12 |
Putting the Heater into Service .................................................................................................................. |
12 |
Heater Operating Instructions .................................................................................................................... |
13 |
To Turn Off Gas to the Appliance................................................................................................................... |
13 |
Safety Controls (Air Flow Switches, Water Pressure Switches, Hight Limit Shut-Off Switches)..................... |
14-15 |
(Stack Flue Sensor, Thermal Fuse, Float Switch) |
|
Ignition Module Operation........................................................................................................................... |
15 |
Section 2. Installation.................................................................................................. |
16 |
Heater Description.......................................................................................................................................... |
16 |
Putting the Heater into Service....................................................................................................................... |
16 |
Sequence Of Operation.................................................................................................................................. |
17 |
Specifications.................................................................................................................................................. |
17-18 |
Plumbing Connections.................................................................................................................................... |
19 |
Water Connections.......................................................................................................................................... |
19 |
Multiple Heater Connections........................................................................................................................... |
20 |
Valves............................................................................................................................................................. |
21 |
Manual By-Pass.............................................................................................................................................. |
21 |
Below Pool Installation.................................................................................................................................... |
21 |
Gas Connections............................................................................................................................................. |
22 |
Gas Pipe Sizing .............................................................................................................................................. |
22 |
Gas Pressure Testing..................................................................................................................................... |
23 |
Checking Gas Pressure Through Gas Control Valve...................................................................................... |
23 |
Sediment Traps............................................................................................................................................... |
24 |
Outdoor Installation (US and Canada)............................................................................................................ |
24-26 |
Outdoor Installation Venting Guidelines ..................................................................................................... |
26 |
Heater Clearances - Outdoor ..................................................................................................................... |
28 |
Indoor Venting — General Requirements (Category IV Vertical and Horizontal requirements)..................... |
28 |
Heater Clearances — General Requirements (Indoor and Outdoor Installation for US and Canada) ......... |
28 |
Direct Air Intake Cover.................................................................................................................................... |
28 |
Combustion Air Supply.................................................................................................................................... |
29 |
Air Supply Requirements Guide for the ETi 400 Heater............................................................................. |
29 |
Direct Air Intake Exhaust Duct using 4-inch PVC Pipe (Indoor Installation)............................................... |
30-36 |
Direct Air Intake Kit Installation (Combustion Air Supply)........................................................................... |
31 |
Corrosive Vapors and Possible Causes.......................................................................................................... |
32 |
Horizontal or Vertical Venting (Category IV) - Positive Pressure................................................................... |
33 |
Vent Installation (Indoor Installation for U.S. or Outdoor Shelter for Canada)................................................ |
34 |
Direct Vent Requirements............................................................................................................................... |
34-35 |
Rev. E 3/2020 |
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
4 Contents
Contents |
|
Section 2. Installation (Continued) ............................................................................... |
38 |
Vent Installation - Indoor Installation (US and Canada).................................................................................. |
36 |
Garage or Utility Room Installation (Vent Installtion - Indoor Installation US and Canada)............................ |
37 |
Final Installation Check................................................................................................................................... |
37 |
Condensate Management (Maintenance, Condensate Neutralizer Cartridger Drain/Tubing Installation)...... |
38 |
Electrical Connections..................................................................................................................................... |
39 |
Bonding...................................................................................................................................................... |
39 |
120 VAC / 240 VAC Wiring......................................................................................................................... |
40 |
Remote Control Connections.......................................................................................................................... |
41 |
Fireman’s Switch Connection.......................................................................................................................... |
41 |
Heater Connection Wiring Diagram................................................................................................................ |
42 |
Heater Ladder Wiring Diagram....................................................................................................................... |
43 |
Section 3. Troubleshooting......................................................................................... |
44 |
Initial Troubleshooting and Error / Fault Codes............................................................................................... |
44 |
Initial Troubleshooting Chart........................................................................................................................... |
45 |
Heater Will Not Fire A.................................................................................................................................. |
46 |
Heater Will Not Fire B.................................................................................................................................. |
47 |
Diagnostics LEDs: PS, HLS, TF, IGN, AFS, AG1, AG2, FS ....................................................................... |
48-52 |
Burner Troubleshooting................................................................................................................................... |
53 |
Heat Exchanger Troubleshooting.................................................................................................................... |
53 |
Operator Control Panel Displays RNC Code.................................................................................................. |
53 |
Section 4. Maintenance and Care Instruction........................................................... |
54 |
Care and Maintenance...................................................................................................................... |
54 |
TitanTough Heat Exchanger Assemblies Annual Inspection............................................................. |
54 |
Burner Spark Electrode and Flame Sensor Rod Annual Inspection.................................................. |
55 |
Pressure Relief Valve (50 psi)........................................................................................................... |
55 |
After Start-Up..................................................................................................................................... |
56 |
Spring and Autumn........................................................................................................................ |
56 |
Winter Operation and Winterization............................................................................................... |
56 |
Return the Heater to Service............................................................................................................. |
57 |
Maintaining Pool Temperature........................................................................................................... |
57 |
Energy Saving Tips........................................................................................................................ |
57 |
Chemical Balance.............................................................................................................................. |
58-59 |
Section 5. Heater Replacement Parts........................................................................ |
60-66 |
Heater Replacement Parts List.......................................................................................................... |
61 |
General Replacement Parts.............................................................................................................. |
61 |
Heater Heat Exchanger and Blower Assemblies Replacement Parts............................................... |
64 |
Heater Manifold Assembly - Inlet and Outlet Assembly Replacemant Parts..................................... |
64 |
Heater Condensate and Exhaust Assembly Replacement Parts...................................................... |
65 |
Heater Operator Control Panel Assembly Replacement Parts.......................................................... |
66 |
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
Rev. E 3/2020 |
Warning and Safety Instructions 5
Warning and Safety Instructions
IMPORTANT SAFETY INSTRUCTIONS
READ AND FOLLOW ALL INSTRUCTIONS
SAVE THESE INSTRUCTIONS
ETi® 400 High Efficiency Pool and Spa Heater
Thanks you for choosing the Pentair ETi® 400HighEfficiencyPoolandSpaHeater.Withproperinstallationandservice of your new heating system, and correct chemical maintenance of the water will ensure years of heater operation. The ETi 400 High Efficiency heater is equipped with Pentair advanced heater technology which includes a multifunction temperature controller to continuously monitor the heater for proper operation. ETi 400 High Efficiency heaters are designed with direct spark ignition (DSI) for on demand heat, which eliminates the need for a standing pilot.
SPECIAL INSTRUCTIONS TO OWNER: Retain this manual for future reference.This instruction manual provides operating instructions, installation and service information for the heater. READ AND REVIEW THIS MANUAL COMPLETELY, it is very important that the owner/installer read and understand the section covering installation instructions, and recognize the local and state codes before installing the ETi 400 High Efficiency heater. Its use will reduce service calls and chance of injury and will lengthen product life. History and experience has shown that most heater damage is caused by improper installation practices.
IMPORTANT NOTICES
For the installer and operator of the ETi 400 High Efficiency Heater: The manufacturer’s warranty may be void if, for any reason, the heater is improperly installed and/or operated. Be sure to follow the instructions set forth in this manual. If you need any more information, or if you have any questions regarding to this pool heater, please contact Pentair Water Pool and Spa Customer Support at (800) 831-7133.
HEATER APPLICATION INFORMATION
The ETi 400 Heater is sold with a limited factory warranty. Pentair Water Pool and Spa high standards of excellence include a policy of continuous product improvement resulting in your advanced technology pool and spa heater. Pentair reserves the right to make improvements which change the specifications of the heater without incurring an obligation to update the current heater equipment.
TheETi400Heaterisdesignedfortheheatingofchlorine,bromineorsaltsystemswimmingpoolsandspas.Theheater shouldneverbeemployedforuseasspaceheatingboilersorgeneralpurposewaterheaters.Themanufacturer’swarranty may be void if, for any reason, the heater is improperly installed and/or operated. Be sure to follow the instructions set forth in this manual.
CODE REQUIREMENTS
Installation must be in accordance with all local codes and/or the latest edition of the National Fuel Gas Code, ANSI Z223.1 and the latest edition of the National Electrical Code, NFPA70 (US).
Installation in Canada must be in accordance with the latest CAN/CGA-B149.1 or .2 and CSA C22.1 Canadian Electric Code, part 1.
The heater, when installed, must be electrically grounded and bonded in accordance with local codes, or, in absence of local codes, with the National Electrical Code,ANSI/NFPA70 (US) or in Canada in accordance with the Canadian Electric Code, part 1 as applicable.
The ETi 400 Pool Heater meets the requirements of theASME Boiler and Pressure Vessel Code.
Rev. E 3/2020 |
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
6 Warning and Safety Instructions
CONSUMER INFORMATION AND SAFETY
WARNING
The U.S. Consumer Product Safety Commission warns that elevated water temperature can be hazardous. See below for water temperature guidelines before setting temperature.
1.Spaorhottubwatertemperaturesshouldneverexceed104°F(40°C). Atemperatureof100°F(38°C)isconsidered safe for a healthy adult. Special caution is suggested for young children.
2.Drinking of alcoholic beverages before or during spa or hot tub use can cause drowsiness which could lead to unconsciousness and subsequently result in drowning.
3.Pregnant women beware! Soaking in water above 102° F (39° C) can cause fetal damage during the first three months of pregnancy (resulting in the birth of a brain-damaged or deformed child). Pregnant women should stick to the 100° F (38° C) maximum rule.
4.Before entering the spa or hot tub, the user should check the water temperature with an accurate thermometer. Spa or hot tub thermostats may error in regulating water temperatures by as much as 4° F (2.2° C).
5.Persons with a medical history of heart disease, circulatory problems, diabetes or blood pressure problems should obtain their physician’s advice before using spas or hot tubs.
6.Persons taking medication which induce drowsiness, such as tranquilizers, antihistamines or anticoagulants should not use spas or hot tubs.
WARNING
Should overheating occur or the gas supply fail to shut off, turn off the manual gas control valve to the heater. Do not use this heater if any part has been under water. Immediately call a qualified service technician to inspect the heater and to replace any part of control system and gas control which has been under water.
WARNING
The U.S. Consumer Product Safety Commission warns that carbon monoxide is an “invisible killer”. Carbon monoxide is a colorless and odorless gas.
1.Carbon monoxide is produced by burning fuel, including natural gas and propane.
2.Proper installation, operation and maintenance of fuel-burning appliances in the home is the most important factor in reducing carbon monoxide poisoning.
3.Be sure that fuel burning appliances such as heaters are installed by professionals according to manufacturer’s instructions and codes.
4.Always follow the manufacturer’s directions for safe operation.
5.Have the heating system (including vents) inspected and serviced annually by a trained service technician.
6.Examine vents regularly for improper connections, visible cracks, rust or stains.
7.Installbattery-operatedcarbonmonoxidealarms.Thealarmsshouldbecertifiedtotherequirementsofthemost recentUL,IAS,CSAandIAPMOstandardforcarbonmonoxidealarms.Testcarbonmonoxidealarmsregularly and replace dead batteries.
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
Rev. E 3/2020 |
Warning and Safety Instructions 7
SAFETY INFORMATION
The ETi® 400 High Efficiency Pool and Spa Heater is designed and manufactured to provide many years of safe and reliable service when installed, operated and maintained according to the information in this manual. Throughout this manual, safety warnings and cautions are identified by the “ “ symbol. Be sure to read and comply with all of the warnings and cautions.
DANGER — CARBON MONOXIDE GAS IS DEADLY
READ OWNERS MANUAL COMPLETELY BEFORE OPERATING
THISPRODUCTMUSTBEINSTALLEDANDSERVICEDBYAPROFESSIONALSERVICETECHNICIAN, QUALIFIED IN POOL HEATER INSTALLATION. Some jurisdictions require that installers be licensed. Check with your local building authority about contractor licensing requirements. Improper installation and/or operation could create carbon monoxide gas and flue gases which could cause serious injury or death. Improper installation and/or operation will void the warranty.
Exhaust from this pool heater contains toxic levels of carbon monoxide, a dangerous, poisonous gas you cannot see or smell. Symptoms of carbon monoxide exposure or poisoning include dizziness, headache, nausea, weakness, sleepiness, muscular twitching, vomiting and inability to think clearly. IF YOU EXPERIENCEANYOFTHEABOVESYMPTOMS,IMMEDIATELYTURNOFFTHEPOOLHEATER,LEAVE THE VICINITY OF THE POOL OR SPA AND GET INTO FRESH AIR IMMEDIATELY. THE POOL HEATER MUST BE THOROUGHLY TESTED BY A GAS PROFESSIONAL BEFORE RESUMING OPERATION.
EXCESSIVE CARBON MONOXIDE EXPOSURE CAN CAUSE BRAIN DAMAGE OR DEATH.
•NEVER use this pool heater indoors without specified ventilation system (and properly installed vent pipe).
•NEVER use this pool heater in the home or in partly enclosed areas (such as garages), unless the specified ventilation system is used. If used outdoors, install far from open windows, doors, vents and other openings.
•Pentair strongly recommends that all vents, pipes and exhaust systems be initially and periodically tested for proper operation. This testing can be accomplished by using a hand-held carbon monoxide meter and/or by consulting with a gas professional.
•Pool heaters must be used in conjunction with carbon monoxide detectors installed near the pool heater. The carbon monoxide detectors must be periodically inspected for proper operation so as to insure continued safety. Broken or malfunctioning carbon monoxide detectors must be replaced immediately.
WARNING — FOR YOUR SAFETY
This product must be installed and serviced by a professional service technician, qualified in pool heater installation. Some jurisdictions require that installers be licensed. Check with your local building authority about contractor licensing requirements. Improper installation and/or operation could create carbon monoxide gas and flue gases which could cause serious injury or death. Improper installation and/or operation will void the warranty.
WARNING — This heater is equipped with an unconventional gas control valve that is factory set at a pressure of -.2 inches wc. Improper installation, adjustment, alteration, service or maintenance can cause property damage, personal injury or loss of life. Installation or service must be performed by a qualified installer, service agency or the gas supplier. If this control is replaced, it must be replaced with an identical control.
Do not attempt to adjust the gas flow by adjusting the regulator setting.
Rev. E 3/2020 |
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
8 Warning and Safety Instructions
SAFETY INFORMATION (continued)
WARNING — Risk of fire or explosion from incorrect fuel use. Do not try to run a heater set up for natural gas on propane gas or vice versa. Only qualified service technicians should attempt to convert heater from one fuel to the other. Do not attempt to alter the rated input or type of gas by changing the orifice. If it is necessary to convert to a different type of gas, consult your Pentair dealer. Serious malfunction of the burner can occur which may result in loss of life. Any additions, changes, or conversions required in order for the appliance to satisfactorily meet the application needs must be made by a Pentair dealer or other qualified agency using factory specified and approved parts. The heater is available for use with natural gas or LP (propane) gas only. It is not designed to operate with any other fuels. Refer to the nameplate for the type of gas the heater is equipped to use.
•Use heater only with the fuel for which it is designed.
•If an LP (propane) gas conversion is necessary, this MUST be done by a qualified professional service technician qualified in pool heater installation or by qualified gas supplier before the herater is operational.
WARNING — Risk of fire or explosion from flammable vapors. Do not store gasoline, cleaning fluids, varnishes, paints, or other volatile flammable liquids near heater or in the same room with heater.
WARNING — Risk of explosion if unit is installed near propane gas storage. Propane (LP) gas is heavier than air. Consult local codes and fire protection authorities about specific installation requirements and restrictions. Locate the heater away from propane gas storage and filling equipment as specified by the Standard for the Storage and Handling of Liquefied Petroleum Gases, CAN/CSA B149.2 (latest edition) or ANSI/NFPA 58 (latest edition).
WARNING — Risk of fire, carbon monoxide poisoning, or asphyxiation if exhaust venting system leaks. Only qualified service technicians should attempt to service the heater, as leakage of exhaust products or flammable gas may result from incorrect servicing.
WARNING — Risk of asphyxiation if exhaust is not correctly vented. Follow venting instructions exactly when installing heater. Do not use a draft hood with this heater, as the exhaust is under pressure from the burner blower and a draft hood will allow exhaust fumes to blow into the room housing the heater. The heater is supplied with an integral venting system for indoor installation. Canada: In Canada, this pool heater can only be installed outdoors or in an enclosure that is not normally occupied and has no openings directly into occupied areas. See Page 25 - 29 for enclosure venting requirements.
CAUTION — Label all wires prior to disconnection when servicing controls. Wiring errors can cause improper and dangerous operation. Wiring errors can also destroy the control board.
•Connect heater to 120 or 240 Volt, 60 Hz., Single Phase power only.
•Verify proper operation after servicing.
•Do not allow children to play on or around heater or associated equipment.
•Never allow children to use the pool or spa without adult supervision.
DANGER
CARBON MONOXIDE GAS IS DEADLY – Exhaust from this pool heater contains toxic levels of carbon monoxide, a dangerous, poisonous gas you cannot see or smell.
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
Rev. E 3/2020 |
Warning and Safety Instructions 9
GENERAL SPECIFICATIONS
NOTICE
•Combustion air contaminated by corrosive chemical fumes can damage the heater and will void the warranty.
•The Combination Gas Control Valve on this heater differs from most appliance gas controls. If it must be replaced, for safety reasons replace it only with an identical gas control valve.
•The heater’s access side panels must be in place to provide proper ventilation and to avoid water intrusion. Do not operate the heater for more than five (5) minutes with the side panels removed.
•This heater is certified by CSAInternational as complying with the Standard for Gas Fired Pool Heaters, ANSI Z21.56/CSA4.7, and is intended for use in heating fresh water swimming pools or spas.
•The ETi® 400 Heater is designed for the heating of chlorine, bromine or salt system swimming pools and spas. It should NOT be used as a space heating boiler, or general purpose water heater.
•The heater should be located in an area where leakage of the heater or connections will not result in damage to the area adjacent to the heater or to the structure. When such locations cannot be avoided, it is recommended that a suitable drain pan, adequately drained, be installed under the heater. The pan must not restrict air flow.
•The heater may not be installed within 5 ft. (1.5M ) of the inside surface of a pool or spa unless it is separated by a solid fence, wall or other permanent barrier.
•In the United States, installation must be in accordance with local codes and the most recent edition of the National Fuel Gas Code,ANSI Z223.1/NFPA-54. The Code can be obtained from: National Fire Protection Association 1 Batterymarch Park Quincy, MA02169 www.nfpa.org
•In Canada, install the heater in accordance with local codes and the most recent edition of the Natural Gas and Propane Installation Code, CAN/CSAB149.1.
Heater Identification Information (HIN)
To identify the heater, see rating plate on the inner front panel of the heater. There are two designators for each heater, one is the Model Number and the other is the Heater Identification Number (HIN).
Heater Identification Number (HIN)
The following example simplifies the identification system:
1) |
ETi |
|
|
|
|
|
|
|
|
|
|
|
|
H. I. N. |
||||||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|||||||
2) |
Model Size : (400) : Input rating (Btu/hr) |
|
|
|
|
|
|
|
|
|
|
HEATER IDENTIFICATION NUMBER |
||||||||
|
X 1000 |
|
|
ID DESIGNATOR FOR PENTAIR WATER POOL AND SPA, ETi HEATER |
||||||||||||||||
3) |
Fuel Type : NA = Natural gas |
Example: |
|
|
|
|
|
|
|
|
|
|
|
|
||||||
4) |
Construction : ASME = Commercial Model |
1 |
2 |
|
3 |
4 |
|
|
|
|
|
|
|
|||||||
|
ETI |
|
400 |
|
NA |
|
ASME |
|
|
|
||||||||||
|
|
|
||||||||||||||||||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
||||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
CONSTRUCTION = ASME = COMMERCIAL MODEL |
|
||||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
||||||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
FUEL TYPE = |
NA = NATURAL GAS |
|
|
||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
||||||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
MODEL SIZE = BTU INPUT in 1000 of BTU / HR |
|
|
|||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
||||||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
ETi = High Efficiency |
|
|
|||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
||||||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
Rev. E 3/2020 |
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
10 Section 1: Operation Instructions
Section 1: Operation Instructions
OPERATOR CONTROL PANEL
Temperature |
Digital Temperature |
Up and Down |
Display |
TEMPERATURE SETTING
The ETi® 400 Heater is shipped factory set at 70° F (35° C) for pool mode and 95° F (21° C) for spa mode. Using the up and down arrows, you can set the thermostats to a minimum temperature of 65° F (18.3° C), or a maximum of 104° F (40° C).
System Operation |
|
|
Heater |
|
"OFF" |
|
|||||
Dual Temperature |
|
||||
Indicator Lights |
Controls |
Switch |
The heater operator controls are as follows:
POOL ON |
Press this button to control the heater operation by the pool temperature setting. |
SPA ON |
Press this button to control the heater operation by the spa temperature setting. |
HEATER OFF |
Press this button to switch off the heater. |
▲TEMP |
Press this button to raise the temperature setting. |
▼ TEMP |
Press this button to lower the temperature setting. |
To toggle the display between degrees Centigrade (°C) and degrees Fahrenheit (°F):
1.Press the HEATER OFF button to switch the heater OFF.
2.Press ▲ TEMP or ▼ TEMP for 5 seconds. The display will flash once and change modes (°C to °F or vice versa).
3.Press the HEATER OFF button to switch the heater ON.
When either the ▲ TEMP or ▼ TEMP buttons are depressed, the digital display will indicate the temperature setting. After five seconds, the display will return to the actual pool/spa temperature.
In addition to the digital temperature display, there are five indicator lights:
The POOL ON light indicates the pool water temperature is controlling the heater operation. The SPA ON light indicates the spa water temperature is controlling the heater operation.
The HEATING lightcomesonandstaysonwhentheheater’sburnerchamberisfiring.Thislightshouldbeonwhenever the burner is on. This light blinks when the heater is calling for heat but not firing. If this light is on but the burner fails to come on, one of the “service” lights should come on, indicating a fault in the system.
The SERVICE SYSTEM light indicates that there is insufficient water flow to the heater. If the pump is operating, this usually indicates that the filter and/or skimmers should be cleaned (some filters may require back-washing). If the light remains on after the filter/skimmers have been serviced, the system should be checked by a qualified service technician.
The SERVICE HEATER light indicates a fault in the heater or its controls. If this light comes on, shut down the heater (See TO TURN OFF GAS TO THEAPPLIANCE on page 13),andhaveaqualifiedservicetechniciancheckthesystem.
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
Rev. E 3/2020 |
Section 1: Operation Instructions 11
OPERATOR CONTROL PANEL
VIEW FAULT CODES: Press the POOLON button and the ▲ TEMP button to view the last fault code.
Press the ▲ TEMP button to scroll up to view the previous 4th. fault codes. The next message displayed after the 5th. fault code is END.
VIEW STACK FLUE GAS TEMPERATURE: Press and hold the POOLON (or SPAON) button for more than 5 seconds to view the current Stack Flue Gas temperature. Each heat exchange has one temperature sensor (SF1 and (SF2), the SF1 temperature is displayed on the heater’s LCD with a dot on the upper left corner of the LCD. Scroll up or down to display the SF2 current temperature and the dot will not be displayed on the LCD.
BASIC SYSTEM OPERATION
Start the pump. Be sure the pump is running and primed to close the water pressure switch and supply power to heater. Be sure the pool and/or spa is properly filled with water. Follow the Lighting and Operating instructions below.
WARNING
Risk of explosion or fire causing burns or death if safety interlocks are disabled. DO NOT attempt to operate heater when SERVICE HEATER light is on or if blower or burner will not start. Instead, follow instructions under “To Switch Off Gas to the Appliance,” and call a qualified service technician to repair unit.
HEATER DSI ELECTRONIC IGNITION LIGHTING/OPERATION
FOR YOUR SAFETY: READ BEFORE LIGHTING
WARNING
If you do not follow these instructions exactly, a fire or explosion may result causing property damage, personal injury or loss of life.
Do not attempt to light the heater if you suspect a gas leak. Lighting the heater can result in a fire or explosion which can cause personal injury, death, and property damage.
Rev. E 3/2020 |
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
12 Section 1: Operation Instructions
BASIC SYSTEM OPERATION (CONTINUED)
START-UP AND OPERATION
START-UP AND SHUTDOWN INSTRUCTIONS ARE ON THE LABEL ATTACHED TO THE INSIDE COVER OF THE APPLIANCE WATER CONNECTION PANEL.
BEFORE START-UP
A.This appliance does not have a pilot. It is equipped with an ignition device which automatically lights the burners. DO NOT try to light the burners by hand.
B.BEFORE OPERATING, smellallaroundtheappliance area for gas. Be sure to smell next to the floor because some gas is heavier than air and will settle on the floor.
WHAT TO DO IF YOU SMELL GAS
–Do not try to light any appliance.
–Donottouchanyelectricalswitch;donotuseanyphone in your building.
–Immediately call your gas supplier from a neighbor’s phone. Follow the gas supplier’s instructions.
–If you cannot reach your gas supplier, call the Fire Department.
C.Use only your hand to turn the gas control on or off. Never use tools. If you cannot change the ON/OFF setting by hand, don’t try to repair it, call a qualified servicetechnician.Forcedorattemptedrepairmayresult in a fire or explosion.
D.Do not use this heater if any part has been under water. Immediatelycallaqualifiedservicetechniciantoinspect the heater and to replace any part of the control system and any gas control which has been under water.
E.Do not operate the pool heater unless the pool or spa is properly filled with water.
F.Before operating the appliance for the first time or after it has been off for an extended time, perform the following checklist:
1.Removedebrisorotherarticlesfrominsidetheheater and the area around the heater and its exhaust vent. Makesuretheventilationopeningsareclearofdebris orobstruction.Forinstallationsinanenclosedspace, make sure openings for combustion and ventilation air are unobstructed.
2.Keep heater area clear and free from combustibles, flammable liquids and chemicals.
3.Check that all water connections are tight.
4.Water must be flowing through the heater during operation.Makesurethatpool/spaisfilledwithwater and have pump operating. Check that water flow is unobstructed from the appliance. When operating forthefirsttimeorafteranextendedshut-down,run filter pump for several minutes to clear all air from the system.
PUTTING THE HEATER INTO SERVICE
If the heater’s Water Pressure Switches (PS) are below or above the water level by 1 ft (30 cm), after the heater installation the Water Pressure Switch setting should be adjusted. See WATER PRESSURE SWITCH, in SAFETY
CONTROLS on page 14.
Note: Before putting the heaterinto service forthe first time, follow the instructions underBEFORE START-UP onpage12.CheckforproperoperationoftheheaterbyfollowingthestepsunderOPERATINGINSTRUCTIONS on page 13. Damage to equipment caused by improper installation or repair will void the warranty.
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
Rev. E 3/2020 |
Section 1: Operation Instructions |
13 |
HEATER OPERATING INSTRUCTIONS
1.STOP! Read the safety information on (page 12).
2.Set both pool and spa thermostats to the lowest settings.
3.Turn off all electric power to the appliance.
4.This appliance does not have a pilot. It is equipped with an ignition device which automatically lights the burner. Do not try to light the burner by hand.
5.Remove the access door panels by unfastening the latch located on each door, then lift up and out from the bottom of the panel
to remove.
6.Toggle-Style Valve: Pull toggle toward you to turn gas off , see Figure 1.
7.Wait five (5) minutes to clear out any gas. If you then smell gas,
STOP! Follow B in the BEFORE START-UPinstructions on page 12. If you don’t smell gas, go to the next step.
8.Push the toggle switch away from you to switch the gas on.
Gas control is shown OFF. Push toggle switch
away from you to switch ON.
Figure 1.
9.Replace the DoorAccess Panels.All panels must be in place when operating the heater.
10.Set 3-way valves on inlet and outlet to pool or spa, as appropriate.
11.Turn on all electric power to the appliance.
12.Press either the POOLON or SPAON button switch on the operating control.
13.Set the thermostat to desired setting. NOTICE: Setpoint must be above actual water temperature or burner will not fire. See OPERATOR CONTROLPANELon page 11.
14.The blower should come on immediately, and after about 15 seconds, the burner should fire. When operating for the first time, the burner may not fire on the first try because of air in the gas line. If it does not fire at first, push the OFF switch, wait five minutes, and again push the POOLor SPAON switch. The burner should fire after about 15 seconds.You may have to repeat this until all of the air has cleared the gas line.
15.The burner should fire until the pool/spa temperature reaches the desired temperature set on the thermostat. The blower will continue to run for about 45 seconds after the burner shuts off. If any of the safety interlocks should open during burner operation, the burner shuts off immediately, but the blower continues to run for about 45 seconds. Should overheating occur or the gas supply fail to shut off, turn off the manual gas control valve to the appliance.
16.If the appliance will not operate, follow the instructions TO TURN OFF GAS TO THE APPLIANCE below, and call your service technician or gas supplier.
17.If the electrical power is shut off to the heater while it is running, once power is restored, the heater will power up with the previous programed settings.
TO TURN OFF GAS TO APPLIANCE
1.Press the OFF button on operating control.
2.Switch off all electric power to the unit.
3.Remove the access door panels.
4.Toggle-Style Valve: Pull toggle toward you to turn gas off, see Figure 1.
5.Replace theAccess Door Panels.
Rev. E 3/2020 |
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
14 Section 1: Operation Instructions
SAFETY CONTROLS
AIR FLOW SWITCH (AFS)
There are two air flow switches, (see Figure 2), designed as a safety device to ensure thetwocombustionairblowers(fans)areoperatingandaremonitoringthedifferential (negative)pressurewithintheblowerhousing.Theseairpressureswitchesarefactory set. The switches (see page 63 #29) are connected upstream of the ignition module. The ignition module does not operate unless the air flow switches and all safety switches are closed.
WATER PRESSURE SWITCHES
WARNING
Hazardous pressure. Do not bypass the Water Pressure Switches or render it inoperable.
Figure 2. Air Flow Switch
The heater has two Water Pressure switches, see Figure 3. If the water flow is restricted, the water pressure switches may prevent the burner from firing and cause the Service SystemLEDindicatortogoon.Note: If the light remains on after the filter has been serviced, have a qualified service technician check the system.
For deck-level heater installations, the Water Pressure switches are factory set at 3.00 psi (20.6kPa).Note:
See Below Pool Level Installation, on page 21. If the pressure switches are 1 ft (0.3M) below or above the pool water level, reset the switches so that it is open when the pump is off and closed when the pump is running. Turn the star-wheel on the switch clockwise ( ) to raise setting (heater below the pool level) and counterclockwise ( ) to lower the setting (heater above the pool level), see Figure 4. Test each switch after resetting.
NOTICE: When the heater is mounted more than
1 ft (30 m) above or 1 ft (30 cm) below the deck level, a pressure switch is no longer adequate. A Flow Switch must be installed instead.
CAUTION! Heater operation with an incorrect water pressure switch setting, may cause the heater to operate without sufficient water flow, and may cause severe heater damage.
HIGH LIMIT SWITCH AND AUTOMATIC GAS SHUT-OFF SWITCHES (AG1 AND AG2)
AHigh Limit Switch (HLS), is a safety device that opens the electrical circuit and shuts off the heater based on a water temperature set point within the HLS. The heater contains twoAGS switches and one HLS switch. TheAGS switches are located in the outlet plumbing assembly, and the HLS switch is located on the main Inlet/Outlet Header (see page 16).
Water Pressure |
Switch |
Star Wheel |
Figure 3: Water Pressure Switch |
Turn star wheel clockwise to raise pressure set point if water pressure switch is more than 1 ft (30 cm) below water level
Water Pressure |
Switch |
Star Wheel |
A reference scale is on |
the back of pressure switch |
Turn star wheel counterclockwise to lower pressure set point if pressure switch is more than 1 ft (30 cm) above water level
Figure 4.
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
Rev. E 3/2020 |
Section 1: Operation Instructions 15
SAFETY CONTROLS (continued)
STACK FLUE SENSORS (SF1, SF2)
The heater is equipped with two Stack Flue sensors; one for each heat exchanger. These sensors monitor the stack flue temperature and if needed will shut down the heater if the stack flue temperature exceeds 170° F (77° C).
THERMAL FUSE
AThermal Fuse (TF) is a safety protection device that opens the electrical circuit if the temperature reaches 187° F (86° C). The fuse cannot be reset, it must be replaced. See page 17 for more information.
FLOAT SWITCH
The Float Switch (FS) is a sensing application that shuts down the heater once the condensate level exceeds the permitted level in the condensate container. See page 17 for more information.
IGNITION MODULE OPERATION
The Ignition Module, (Figure 5), is microprocessor based and operates on 24VAC supplied by the transformer. The control works in conjunction with a fan control board (Figure 6), and utilizes a microprocessor to continually safely monitor, analyze, and control the proper operation of the gas flame holder. The module with the presence of the flame sensor, using flame rectification, allows the heater to operate.
Flame Current |
Diagnostic LED |
|
|||
Check Point |
|
||||
1 |
Flash |
- |
Air Flow Fault |
|
|
|
|
||||
|
2 |
Flashes - Flame No Call for Heat |
Heater left side panel removed |
||
|
3 |
Flashes - |
Ignition Lockout |
||
|
|
||||
|
|
|
|
|
PS1 |
|
|
|
|
|
PS2 |
|
|
|
|
|
TH |
|
|
|
|
|
START |
|
|
|
|
|
NC IN |
|
FAN1 |
|
FAN2 |
|
L1 |
|
UNUSED |
|
GND |
|
R 24 VAC |
Figure 5. Ignition Control Module |
Figure 6. Fan Control Circuit Board |
Rev. E 3/2020 |
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
16 Section 2: Installation Instructions
Section 2: Installation Instructions
THIS HEATER MUST BE INSTALLED AND SERVICED BY A PROFESSIONAL SERVICE TECHNICIAN, QUALIFIED IN POOL HEATER INSTALLATION.
Pentair strongly recommends that all vents, pipes and exhaust systems be initially and periodically tested for proper operation. This testing can be accomplished by using a hand-held carbon monoxide meter and/or by consulting with a gas professional. Pool and spa heaters must be used in conjunction with carbon monoxide detectors
installed near the pool heater. The carbon monoxide detectors must be periodically inspected for proper operation so as to insure continued safety. Broken or malfunctioning carbon monoxide detectors must be replaced immediately.
HEATER DESCRIPTION
The ETi® 400 Heater has precisely matched orifice plates to meter the air and gas into the mixer. The blower draws the air and gas through the mixer and forces it into the burner’s flame holder. A sealed TitanTough™ Heat Exchanger surrounds the flame holder, discharging exhaust gases out the flue (See Figure 7 & 8). Use a 2 in fitting to connect to the 2 in PVC slip unions provided with the heater. The outer manifold remains cool; no heat sinks are required. The heater operator control panel is located on the side of the heater.
Vent Cap |
Inlet Plumbing |
|
|
|
|
|
|
|
|
|
|
|
|
Exhaust |
||
|
Assembly |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
CPVC Flue |
Tridicator (Water pressure and |
|
Assembly |
|||||||||||||
|
|
|||||||||||||||
|
|
|
||||||||||||||
Outlet |
|
Temperature gauges) |
|
|
||||||||||||
Upper Heat |
|
|
Upper Blower |
|
|
|||||||||||
|
|
|
Assembly |
|
|
|||||||||||
Exchanger |
|
|
|
|
|
|||||||||||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
Lower Blower |
|
|
|
|
|
|
|||||||
|
|
|
|
|
|
|
||||||||||
|
|
|
|
|
|
|||||||||||
|
|
High |
Assembly |
|
|
|
|
|||||||||
|
|
|
|
|
||||||||||||
Lower Heat |
|
Limit |
2-in Inlet |
|
|
|
|
|
||||||||
|
Switch |
|
|
|
|
|
||||||||||
|
|
|
|
|
||||||||||||
Exchanger |
|
(HLS) |
Plumbing |
|
|
|||||||||||
|
|
|
||||||||||||||
|
|
|
|
Assembly |
|
|
||||||||||
Auto gas |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
shut-off |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
switch |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
(AGS) |
|
Electrical |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
and |
2-in Outlet |
|
|
|||||||||||
Tubing for |
|
Bonding |
Plumbing |
|
|
|||||||||||
Condensate |
|
lug |
Assembly |
|
|
|||||||||||
Neutralizer |
|
To drain |
To drain |
|
|
|||||||||||
Cartridge |
|
|
|
|||||||||||||
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
Figure 7. ETi® 400 Heater (Left Side View) |
|
|
|
|
Figure 8. ETi® 400 Heater (RIght Side View) |
|||||||||||
|
|
|
|
Condensate Neutralizer Cartridge (Optional, P/N 475612 sold separately).
The cartridge may be mounted onto the heater base for heater outdoor installation.
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
Heater Base (Top View) |
Rev. E 3/2020 |
Section 2: Installation Instructions |
17 |
|
|
|
|
SEQUENCE OF OPERATION
Anelectronictemperaturesensingthermistor inthemanifoldadapterinletcontrolstheheateroperation.Whentheinlet water temperature drops below the temperature set on the operatorcontrol panel, the control board supplies power to the combustion air blowers through a series of safety interlocks. The heater interlocks consist of:
•the two water pressure switches (PS), which senses that the pump is running,
•the tridicator gauges (2) which monitors the water temperature in degree Fahrenheit and pressure in psi.
•the high limit switch (HLS), which opens if the heat exchanger outlet temperature goes above 135° F (57° C), and
•the two air flow switches (AFS), sense the pressure drop across the air metering orifices.
•the two thermal fuses (TF) open if the flue gas temperature reaches 187° F (86° C).
•the automatic gas shut-off (AG1, AG2) switches, which open if the heat exchanger outlet temperature goes above 150° F (66° C).
•the float switch (FS) which opens if the condensate overflows at the float switch due to blockage in the condensate drain hose or neutralizer cartridge.
•the stack flue sensors (SF1, SF1), which shut down the heater if the flue gas temperature reaches 170° F (77° C).
The air flow switches (AFS) sense the pressure differential between both of the air metering orifices.As soon as there is sufficient air flow, theAFS closes, completing the circuit to the Fan Conrol board. The gas ignition control then opens the gas valve and the fuel mixture is ignited by the Direct Spark Ignition (DSI). On a call for heat, the blowers are energized for 15 seconds, the gas valve opens simultaneously as the direct spark igniters are energized, then ignition occurs. The heater is equipped with a digital operating control that enables the user to pre-set the desired pool and spa water temperatures. The control enables the user to select between pool and spa heating, and features a digital display
SPECIFICATIONS
Theinstallationinstructionscontainedinthismanualaredesignedforusebyqualifiedpersonnelonly,trainedespecially for installation of this type of heating equipment and related components. Some states require installation and repair by licensed personnel. If this applies in your state, be sure your contractor bears the appropriate license. See Figure 9, 10 & 11 for Outdoor and Indoor installations, dimensions and orientation of the heater.
Dimensions in Millimeters / Inches
762
30.0
548.1 |
21.6 |
863.6
34.0
664.9
26.2
1012.8
39.9
Figure 9. |
Heater Top View |
Rev. E 3/2020 |
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
18 Section 2: Installation Instructions
SPECIFICATIONS (CONTINUED)
4-IN CPVC FLUE EXHAUST SOCKET |
4-IN PVC AIR INLET CONNECTION |
|
(INDOOR OPTIONAL KIT) |
|
CONTROL CONTROL TOUCH |
|
PAD/ DISPLAY |
1160.5 |
|
45.7 |
|
Figure 10. |
|
Heater Front View
4-IN CPVC FLUE |
|
4-IN PVCVENT CAP |
||||
|
||||||
EXHAUST |
|
|
||||
SOCKET |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
2 in WATER INLET |
|
|
|
|
|
CONNECTIONS |
|
|
|
243.5 |
|
|
|
|
|
9.6 |
|
|
|
|
|
|
|
|
38.1 |
1087.5 |
|
|
|
|
42.8 |
||
|
|
|
Ă |
1.5 |
|
|
|
BONDING LUG |
|
||
|
|
GAS |
|
||
537.3 |
|
|
|
|
|
21.2 |
|
|
|
|
|
421.2 |
|
|
|
|
|
16.6 |
|
|
|
|
226.6 |
|
|
|
|
|
|
|
|
145.6 |
|
|
8.9 |
|
|
5.7 |
|
|
|
|
670.3 |
|
|
|
|
Figure 11. |
26.4 |
22.2 |
|
|
108 |
|
|
Ă .88 |
|
|
|
|
|
|
|
4.3 |
|
|
|
ELECTRICAL |
|
|
|
|
Heater Plumbing Side |
|
|
Heater Rear View |
|
|
|
|
|
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
Rev. E 3/2020 |
Section 2: Installation Instructions |
19 |
|
|
|
|
PLUMBING CONNECTIONS
The heater has the unique capability of direct schedule 40 PVC plumbing connections. Aset of bulkhead fittings is included with the heater to ensure conformity with Pentair’s recommended PVC plumbing procedure. Other plumbing connections can be used. See Figure 12 for plumbing connections.
CAUTION
Before operating the heater on a new installation, turn on the circulation pump and bleed all the air from the filter using the air relief valve on top of the filter. Water should flow freely through the heater. Do not operate the heater unless water in the pool/spa is at the proper level. If a manual by-pass is installed, temporarily close it to ensure that all air is purged from the heater.
WATER CONNECTIONS
INLET
OUTLET
HEATER |
FROM |
PUMP |
|
||
|
FILTER |
FILTER |
|
MANUAL |
|
TO |
BY-PASS |
|
POOL |
GATE |
|
|
VALVE |
|
Figure 12. |
FROM |
|
POOL |
The heater requires proper water flow and pressure foritsoperation.SeeFigure13fortherecommended installation.Thefilterpumpdischargestothefilter, the filter discharges to the heater, and the heater discharges directly to the pool or spa.
A manual bypass valve should be installed before the heater when the pump flow exceeds 120 GPM (454 LPM ). See WATER FLOW RATE Table 1 on page 21 forsettingofthemanualby-passvalve.
Make sure that the outlet plumbing from the heater containsnoshut-offvalvesorotherflowrestrictions that could prevent flow through the heater (except forpoolinstallationsasnotedbelow,orwinterizing valves where needed). To switch flow between the pool and spa, use a diverter valve. Do not use any valve that can shut off the flow.
Install the chemical feeder downstream of the heater. Install a chemical resistant one-way check valve between the heater and the chemical feeder to prevent back-siphoning through the heater when the pump is off.
Note: For Multiple Heater installation, see page 20.
3-Way Valve
Main
Drain
Pool Spa
|
|
|
|
|
|
|
|
|
|
|
|
From Pool |
|
3-Way |
|||||||||
|
|
|
|
|
Valve |
Figure 13.
Chlorinator |
Check Valve |
Heater |
Filter |
Pump
3-Way Valve
NOTICE: If the heater is plumbed in backwards, it will cycle continuously. Make sure piping from filter is not reversed when installing heater.
Connecttheheaterdirectlyto2inPVCpipe,usingtheprovidedunions.Heatsinksarenotrequired.Thelowthermalmass of the heater will prevent overheating of the piping connected to the pump even if the heater shuts down unexpectedly.
Occasionallyatwo-speedpumpwillnotdevelopenoughpressureonthelowspeedtooperatetheheater.Inthiscase,run the pump at high speed only to operate the heater. If this does not solve the problem, do not try to run the heater. Instead, correct the installation.
Do not operate the heater while an automatic pool cleaner is also operating. If the circulation pump suction is plugged (for example by leaves), there may not be adequate flow to the heater. Do not rely on the pressure switch in this case.
Rev. E 3/2020 |
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
20 Section 2: Installation Instructions
MULTIPLE HEATER INSTALLATION
All plumbing on multiple heater installations must be done in parallel. See Figure 14 and Figure 15.
To prevent heater overheating and to ensure heater longevity, water flow to each heater must be balanced for optimum operation. To meet recommended flow rates, be sure all installed pipes are installed in accordance with local
and state codes or, in the absence of local codes, with all applicable codes and industry plumbing standards. To allow for proper operation and service clearance, maintain spacing to adjacent heaters. Heaters installed too close to one another may encounter operational issues associated with exhaust and/or condensation.
TOP INLET PORT |
|
|
|
|
|
(COLD WATER) |
|
|
|
|
Optional Check Valves and |
|
|
|
|
|
|
LOWER OUTLET PORT |
Flow Meter |
Flow Meter |
Flow Meter |
Flow Meter |
Flow Meters on the heater |
(HOT WATER) |
inlets can help to balance |
||||
|
|
|
|
|
the system. |
To balance the system, |
|
|
|
|
To balance the system, |
|
|
|
|
extend the pipe 12 inches |
|
extend the pipe 12 inches |
|
|
|
|
|
|
|
|
|
(305 mm) past the |
|
(305 mm) past the |
|
|
|
|
|
|
|
|
|
end of the heater inlet. |
|
end of the heater inlet. |
|
|
|
|
|
|
|
|
|
|
Firgue 15. Four ETi 400 Heaters Plumbing Hydraulic Diagram
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |
Rev. E 3/2020 |
Section 2: Installation Instructions 21
VALVES
When any equipment is located below the surface of the pool or spa, valves should be placed in the circulation piping system to isolate the equipment from the pool or spa. Check valves are recommended to prevent back-siphoning. Backsiphoning is most likely to occur when the pump stops, creating a pressure-suction differential. Do NOT sanitize the pool by putting chlorine tablets or sticks into the skimmer(s).When the pump is off, this will cause a high concentration of chlorine to enter the heater, which could cause corrosion damage to the heat exchanger.
CAUTION
Exercise care when installing chemical feeders so as to not allow back siphoning of chemical into the heater, filters or pump. When chemical feeders are installed in the circulation of the piping system, make sure the feeder outlet line is down stream of the heater, and is equipped with a positive seal noncorrosive Check Valve, (P/N R172288), between the feeder and heater.
MANUAL BY-PASS
Wherethewaterflowrateexceedsthemaximum120GPM, a manual bypass should be installed. After installing the valve, adjust the valve to bring the flow rate within the acceptable range. Then remove the valve handle or lock it in place to avoid tampering. See Figure 16.
Table 1: Heater Water Pressure.
ETi® |
GPM (min. / max) |
Max. T (°F) / Min T (°F) |
||
400 |
40 / 120 |
35 |
/ |
25* |
|
|
|
|
|
(*) Compare T by observing the Temperature Pressure gauges located inside the heater (see page 16), and the water inlet temperature displayed on the Control Board LCD.
|
COLD WATER INLET |
||
|
WARM WATER OUTLET |
|
|
1. |
Set Manual By-Pass Valve. |
COLD |
|
2. |
Remove Handle. |
||
WATER |
FROM POOL
WARM WATER TO POOL
BELOW POOL INSTALLATION
Figure 16.
If the heater is below water level, the pressure switch must be adjusted.
This adjustment must be done by a qualified service technician. See following CAUTION before installation.
CAUTION
BELOW OR ABOVE POOL INSTALLATION
The water pressure switch is set in the factory at 3.00 PSI (± 0.75 PSI). This setting is for a heater installed at pool level. If the water pressure switch is more than 1 ft (30 cm) below or above the pool level, the water pressure switch must be adjusted by a qualified service technician. Figure 4 on page 14.
FLOW SWITCH
If the water pressure switch is installed more than 3 ft (0.9 m) above the pool or more than 3 ft (0.9 m) below the pool level, you will be beyond the limits of the pressure switch and a flow switch must be installed. Locate and install the flow switch externally on the outlet piping from the heater, as close as possible to the heater. Connect the flow switch wires in place of the water pressure switch wires.
Rev. E 3/2020 |
ETi 400 High Efficiency Pool and Spa Heater Installation and User’s Guide |