Dolmar PC-8140, PC-7330, PC-6430, PC-8135 User Manual

3.7 Mb
Loading...

Instruction and Safety Manual

for Gasoline Power Cuts (page 2 - 33)

Manuel d’instructions et de sécurité

de découpeuse thermiques (page 34 - 65)

WARNING!

Read and understand this Manual. Always follow safety precautions in the Instruction and Safety Manual. Improper use can cause serious injury!

The engine exhaust from this product contains chemicals known to the State of California to cause cancer, birth defects or other reproductive harm. Preserve this Manual carefully!

ATTENTION!

Suivez toujours les conseils de sécurité du présent manuel d’instructions et de sécurité. Une utilisation incorrecte de la découpeuse peut entraîner des blessures graves!

Conservez avec soin ce manuel! Les gaz d’échappement émis par ce produit contiennent des produits chimiques connus par l’Etat de Californie pour provoquer le cancer, des défauts de naissance ou autres dommages de reproduction. Lisez et comprenez ce manuel.

PC-6430, PC-6435 PC-7330, PC-7335 PC-8135, PC-8140

EMISSIONS COMPONENT DEFECT WARRANTY COVERAGE

DOLMAR U.S.A, Inc warrant to the initial retail purchaser and each subsequent owner, that this utility equipment was designed, built, and equipped to conform at the time of initial sale to all applicable regulations of the U.S. Environmental Protection Agency (EPA), and that the engine is free of defects in materials and workmanship which would cause this engine to fail to conform with EPA regulations during its warranty period.

For the components listed under PARTS COVERED, the service dealer authorized by DOLMAR will, at no cost to you, make the necessary diagnosis, repair, or replacement necessary to ensure that the engine complies with applicable U.S. EPA regulations.

EMISSION COMPONENT DEFECT WARRANTY PERIOD

The warranty period for this engine begins on the date of sale to the initial purchaser and continues for a period of 2 years.

PARTS COVERED

Listed below are the parts covered by the Emission Components Defect Warranty. Some of the parts listed below may require scheduled maintenance and are warranted up to the first scheduled replacement point for that part.

Fuel Metering System

Ignition System

Carburetor and internal parts

Spark plugs

Fuel filter, if applicable

Flywheel Magneto

Throttle stopper, if applicable

Ignition Coil

Choke System, if applicable

 

Air Induction System

Miscellaneous Items Used in Above Systems

Air cleaner plate, Air filter

Fuel hoses, clamps and sealing gaskets

Air cleaner case, Intake manifold

 

OBTAINING WARRANTY SERVICE

To obtain warranty service, take your engine to the nearest DOLMAR Service Center authorized by DOLMAR. Bring your sales receipts indicating date of purchase for this engine. The dealer of service authorized by DOLMAR will perform the necessary repairs or adjustments within a reasonable amount of time and furnish you with a copy of the repair order. All parts and accessories replaced under this warranty become the property of DOLMAR.

WHAT IS NOT COVERED

• Conditions resulting from tampering, misuse, improper adjustment (unless they were made by the service dealer authorized by DOLMAR during a warranty repair), alteration, accident, failure to use the recommended fuel and oil, or not performing required maintenance services.

• The replacement parts used for required maintenance services.

• Consequential damages such as loss of time, inconvenience, loss of use of the engine or equipment, etc.

• Diagnosis and inspection charges that do not result in warranty-eligible service being performed.

• Any non-authorized replacement part, or malfunction of authorized parts due to use of non-authorized parts.

OWNER’S WARRANTY RESPONSIBILITIES

As the engine owner, you are responsible for the performance of the required maintenance listed in your owner’s manual. DOLMAR recommends that you retain all receipts covering maintenance on your engine, but DOLMAR cannot deny warranty solely for the lack of receipts or for your failure to ensure the performance of all scheduled maintenance. As the engine owner, you should however be aware that DOLMAR may deny warranty coverage if your engine or a part has failed due to abuse, neglect, improper maintenance or unapproved modifications.

You are responsible for presenting your engine to the nearest service dealer authorized by DOLMAR when a problem exists.

If you have any questions regarding your warranty rights and responsibilities, you should contact the DOLMAR Warranty service Department at 1-888-OPE-PART for the information.

THINGS YOU SHOULD KNOW ABOUT THE EMISSION CONTROL SYSTEM WARRANTY:

MAINTENANCE AND REPAIRS

You are responsible for the proper maintenance of the engine. You should keep all receipts and maintenance records covering the performance of regular maintenance in the event questions arise. These receipts and maintenance records should be transferred to each subsequent owner of the engine. DOLMAR reserves the right to deny warranty coverage if the engine has not been properly maintained. Warranty claims will not be denied, however, solely because of the lack of required maintenance or failure to keep maintenance records.

MAINTENANCE, REPLACEMENT OR REPAIR OF EMISSION CONTROL DEVICES AND SYSTEMS MAY BE PERFORMED BY ANY REPAIR ESTABLISHMENT OR INDIVIDUAL; HOWEVER, WARRANTY REPAIRS MUST BE PERFORMED BY A SERVICE DEALER AUTHORIZED BY DOLMAR. THE USE OF PARTS THAT ARE NOT EQUIVALENT IN PERFORMANCE AND DURABILITY TO AUTHORIZED PARTS MAY IMPAIR THE EFFECTIVENESS OF THE EMISSION CONTROL SYSTEM AND MAY HAVE A BEARING ON THE OUTCOME OF A WARRANTY CLAIM.

If other than the parts authorized by DOLMAR are used for maintenance replacements or for the repair of components affecting emission control, you should assure yourself that such parts are warranted by their manufacturer to be equivalent to the parts authorized by DOLMAR in their performance and durability.

HOW TO MAKE A CLAIM

All repair qualifying under this limited warranty must be performed by a service dealer authorized by DOLMAR. In the event that any emission-related part is found to be defective during the warranty period, you shall notify DOLMAR Warranty service Department at 1-888-OPE-PART and you will be advised of the appropriate warranty service dealer or service providers

where the warranty repair can be performed.

Thank you for purchasing a DOLMAR product!

Congratulations on choosing a DOLMAR Power Cut cutoff saw!

Weareconfidentthatyouwillbesatisfiedwiththismodernpieceof equipment.DOLMARGmbHofHamburg,Germanyistheworld’s oldest manufacturer of gasoline powered chainsaws we got our start in 1927 giving us very extensive experience with power handtools.Likeourchainsaws,theDOLMARPowerCutsfeature specially designed high performance engines with outstanding power to weight ratios, for heavy duty yet lightweight tools.

Other advantages of the DOLMAR Power Cuts:

Sturdy construction and high reliability.

Maintenance free electronic ignition, hermetically sealed to protect against dust and moisture.

Vibration damping with the DOLMAR 2 mass system (D2M) for tireless working even when guiding the Power Cut by hand.

Five-stageair-filtersystemforreliableworkingevenundervery dusty conditions.

Two options for mounting the cutter attachment: Either centrally, for good balance when guiding the unit manually, or on the side, for flush cuts along walls or curbsides or horizontally directly above the ground.

Extensiverangeofresin-bondedanddiamondgritcuttingdiscs, trolley with dust catcher, and systems for supplying water to the disc.

The following industrial property rights apply: US 08510690, SE 95027298, SE 95027306, IT 95000653, IT 95000654, GBM 9412558, GBM 9412559.

We want you to be satisfied with your DOLMAR product.

In order to guarantee the optimal function and performance of your Power Cut and to ensure your personal safety we would request you to perform the following:

Read this Instruction and Safety Manual carefully before putting the Power Cut into operation for the first time, andstrictlyobservethesafetyregulations!Failuretoobserve these precautions can lead to severe injury or death!

WARNING!

Some dust created by power sanding sawing, grinding, drilling, and other construction activities contains chemicals known (to the State of California) to cause cancer, birth defects or other reproductive harm.

Some examples of these chemicals are:

lead from lead-based paints,

crystalline silica from bricks and cement and other masonry products, and

arsenic and chromium from chemically treated lumber.

Your risk from these exposures varies, depending on how often you do this type of work.

To reduce your exposure to these chemicals: work in a well ventilated area, and work with approved safety equipment, such as those dust masks that are specially designed to filter out microscopic particles.

Only for PC-7330, 7335: The Emissions Compliance Period referred to on the emission Compliance label indicates the number of operating hours for which the engine has been shown to meet federal emissions requirements.

Category C= 50 hours, B= 125 hours, and A= 300 hours.

Table of contents

Page

Packing ................................................................................

3

Delivery inventory ...............................................................

4

Symbols ...............................................................................

4

SAFETY PRECAUTIONS

 

Intended use ....................................................................

5

General precautions ........................................................

5

Protective equipment ....................................................

5-6

Fuels / Refuelling .............................................................

6

Putting into operation ......................................................

6

Cutting discs ....................................................................

7

Kickback and lock in ........................................................

8

Working behavior / Method of working ............................

8

Always observe the following when using

 

synthetic resin cutting discs..............................................

9

Cutting metal ...................................................................

9

Cutting masonry and concrete ...................................

9-10

Transport and storage ...................................................

10

Maintenance ..................................................................

11

First aid ..........................................................................

11

Disposal and environmental protection .........................

11

Technical data ...................................................................

12

Denomination of components .........................................

13

PUTTING INTO OPERATION

 

Mounting the cutting disc................................................

14

Tightening the V-belt / Checking V-belt tension .............

15

Installing the pressure water system ........................

15-16

Fuels / Refuelling ......................................................

16-17

Starting the engine ........................................................

18

Cold-starting ..................................................................

18

Warm-starting ................................................................

19

Stop engine ...................................................................

19

Adjusting the carburetor ..................................................

20

MAINTENANCE

 

Changing the V belt .......................................................

21

Cleaning the protection hood ........................................

22

Cleaning / changing the air filter ...............................

22-23

Replacing the spark plug ...............................................

24

Replacing the suction head ...........................................

24

Replacing the starter cable ............................................

25

Replacing the return spring ...........................................

26

Instructions for periodic maintenance ............................

30

Cutting attachment in central / side position .................

27

Repositioning the cutting attachment .......................

27-28

Replacing/cleaning the spark arrester screen ...............

28

SPECIAL ACCESSORIES

 

Diamond cutting discs, trolley, water tank

 

and pressure water system............................................

29

Service, spare parts and guarantee ...........................

30-31

Troubleshooting ................................................................

31

Extract from spare parts list .......................................

32-33

Accessories ...................................................................

33

Service stations (see enclosure)

 

Packing

Your DOLMAR Power Cut is packed in a cardboard box to pre­ vent shipping damage.

Cardboard is a basic raw material and is consequently reuseable or suitable for recycling (waste paper recycling).

In case one of the parts listed should not be included in the delivery inventory, please consult your sales agent.

Delivery inventory

6

5

4

3

2

1

1.Power Cut

2.Cutting disc

3.Adapter ring 0.8"/1.0" (not in the general scope of delivery. Country-specific)

4.Screwdriver (for carburetor adjustment)

5.Offset screwdriver

6. Universal wrench 13/19

7. Instruction manual (not shown)

Symbols

You will notice the following symbols on the Power Cut and in the Instruction Manual:

Read instruction manual and follow the warningand safety precautions!

Particular care and caution!

Forbidden!

Wear helmet and eye, respiratory and hearing protection!

Wear protective gloves!

Wear respiratory protection!

Hazardous dust and/or gas emission!

Fire hazard from flying sparks!

No smoking!

No open fire!

Direction of cutting wheel rotation

Warning: the max. peripheral speed of the cutting disc is 80 m/s!

Cutting disc dimensions

Never use carbide tipped, circular saw blades or any kind of wood cutting blades!

Combination Start/Stop (I/O) switch, choke

Locked / Unlocked

Press decompression valve

Engine - manual start

Working in winter

Stop engine!

Warning!

Kickback!

Fuel and oil mixture

First aid

Recycling

SAFETY PRECAUTIONS

Intended use

Power Cut

Use the Power Cut cutoff saw outdoors only, for trimming and cutting suitable materials, using cutting discs rated for this machine.

Improper use:

Never use the cutoff saw cutting discs for grinding or sanding (using the side of the cutting disc to remove material). The disc can break! Never use the Power Cut with saw blades, cutter blades, brushes, carbide tipped, wood cutting blades etc.

Unauthorised users:

Persons unfamiliar with the Instruction Manual, children, young people, and persons under the influence of alcohol, drugs or medi-

cations must not use the Power Cut.

General precautions

-The operator MUST read this instruction manual to ensure safe operation (even if you already have experience in using cutoff saws). It is important to be familiar with the operation of this particular cutoff saw. Users insufficiently informed will endanger themselves as well as others due to improper handling.

Let only persons who have experience in using cutoff saws work with this unit. When letting another person use the Power Cut, this instruction manual must be provided along with it.

First time operators should ask a specialist to instruct them in working with gasoline powered cutoff saws.

Children and persons under 18 years of age must not be allowed to use this Power Cut. Persons over the age of 16 years may, however, use the Power Cut for the purpose of being trained as long as they are under the supervision of a qualified trainer.

Working with the Power Cut requires high concentration.

-Operate the Power Cut only if you are in good physical condition. If you are tired, your attention will be reduced. Be especially careful at the end of a working day. Perform all work calmly and carefully. The user has to accept liability for others.

-Neverworkwhileundertheinfluenceofalcohol,drugs,medication or other substances which may impair vision, dexterity or judgement.

-A fire extinguisher must be available in the immediate vicinity when working in easily inflammable vegetation or when it has not rained for a long time (danger of fire).

-Asbestos and other materials that can release toxins may be cut onlywiththenecessarysafetyprecautionsandafternotification of the proper authorities and under their supervision or that of a person appointed by them.

-The use of dust-reduction devices is urgently recommended (see Accessories, pressure water tank, water tank).

Protective equipment

-In order to avoid head, eye, hand or foot injuries as well as to protect your hearing the following protective equipment must be used during operation of the Power Cut:

-The kind of clothing should be appropriate, i. e. it should be tightfittingbutnotbeahindrance.Clothinginwhichgrainsofmaterial can accumulate (trousers with cuffs, jackets and trousers with wide open pockets, etc.) must not be worn, particularly when cutting metal.

-Do not wear any jewellery or clothing that can get caught or distract from the operation of the Power Cut.

-It is necessary to wear a protective helmet whenever working with the Power Cut. The protective helmet (A) is to be checked in regular intervals for damage and is to be replaced after 5 years at the latest. Use only approved protective helmets.

-The helmet visor (B) protects the face from dust and material grains. In order to prevent injuries to eyes and face, always

wear protective goggles (C) or visor when using the Power Cut.

-To prevent hearing damage, always wear suitable personal hearing protection. (ear muffs (D), ear plugs, etc.). Octave brand analysis upon request.

-When dry cutting dust producing materials such as stone or concrete, always wear approved respiratory protection

(E).

-Work gloves (F) of tough leather are part of the required work kit of the Power Cut and must always be worn when working with the Power Cut.

1

2

3

4

-Always wear safety shoes or boots (G) with steel toes, non skid soles, and leg protectors when working with the Power Cut. Safety shoes equipped with a protective layer provide protection against cuts and ensure a secure footing.

-Always wear a work suit (H) of tough material with sufficient flame-retardant qualities whenever working with the cutoff saw.

Fuels / Refuelling

-Go to a safe, level place before refuelling. Never refuel while on scaffolding, on heaps of material, or in similar places!

-Switch off the engine before refuelling the Power Cut.

-Do not smoke or work near open fires (6).

-Let the engine cool down before refuelling.

-Fuels can contain substances similar to solvents. Eyes and skin should not come in contact with mineral oil products.Always wear protective gloves when refuelling (not the regular work gloves!). Frequently clean and change protective clothes. Do not breathe in fuel vapors. Inhalation of fuel vapours can be hazardous to your health.

-Do not spill fuel. If a spill occurs, clean off the Power Cut immediately. Fuel should not come in contact with clothes. If your clothes have come in contact with fuel, change them at once.

-Ensure that no fuel oozes into the soil (environmental protection). Use an appropriate base.

-Refuelling is not allowed in closed rooms. Fuel vapors will accumulate near the floor (explosion hazard).

-Ensure to firmly tighten the screw cap of the fuel tank.

-Before starting the engine, move to a location at least 3 meters (approx. 3 1/4 yards) from where you fuelled the Power Cut (7), but not within the extended swing range of the cutting disc (direction of sparks).

-Fuel cannot be stored for an unlimited period of time. Buy only as much as will be consumed in the near future.

-When making up the gasoline/oil mixture, always put the oil in the mixing container first, and then the gasoline.

-Use only approved and marked containers for the transport and storage of fuel.

-Keep fuel away from children!

Putting into operation

-Do not work on your own. There must be someone around in case of an emergency (within shouting distance).

-Observe all anti noise regulations when working in residential areas.

-Never use the Power Cut near inflammable materials or explosive gases! The Power Cut can create sparks leading to fire or explosion!

-Make sure that all persons within 30 meters (33 yards), such as other workers, are wearing protective gear (see "Protective Equipment") (8). Children and other unauthorized persons must remain more than 30 meters away from the working area. Keep an eye out for animals as well (9).

-Before starting work the Power Cut must be checked for perfect function and operating safety according to the prescriptions. In particular, make sure that the cutting wheel is in good condition(replace immediately if torn, damaged or bent), the cutting wheel is properly mounted, the protective hood is locked in place, the hand guard is properly mounted, the V-belt has the proper tension, the throttle moves easily and the halfthrottle lock button functions properly, the grips are clean and dry, and the combination switch functions properly (Start/Stop (I/O) switch, choke).

-Start the Power Cut only after complete assembly and inspection. Never use the Power Cut when it is not completely assembled.

5

6

3 meters

7

30 m

 

 

 

 

 

 

 

 

 

 

 

 

 

8

 

= wearing Protective Equipment

 

 

 

 

 

 

 

 

 

 

 

 

 

 

9

Cutoff discs

-The protection hood must always be on! Change discs only with the engine off!

-There are two basic types of cutoff discs:

-For metal (hot cutting)

-For masonry (cold cutting)

WARNING!

Never use carbide tipped, circular saw blades or any kind of wood cutting blades. Never cut any type of wood. Reactive forces can cause severe personal injury from blade contact or thrown tips.

NOTE: When using diamond cutoff discs, always make sure to observe the "direction of rotation" markings. Diamond discs should only be used for cutting masonry/brick/ concrete etc.

-Cutoff discs are intended only for radial loading, i.e. for cutting. Do not grind with the sides of the cutting disc! This will break the disc (10)!

Caution!

Never change direction (turning radius less than 5 meters / 5 1/2 yards), exert lateral (sideways) pressure, or tip the Power Cut during cutting (11)!

-Use a cutting disc only for cutting the materials it is intended for. The proper type of disc must be used, for either metals or masonry.

-Thearborholeofthecuttingdiscmustbeanexactfitwiththearbor or shaft. If the arbor hole is larger, it must be fitted with an adapter ring (available as an accessory).

-The cutting disc must be rated for freehand cutting at up to 3850 rpm or 80 m/sec for 400 mm discs, 4370 rpm or 80 m/sec for 350 mm discs, or up to 5100 rpm or 80 m/s for 300 mm discs. Use only cutting discs that comply with EN 12413, EN 13236.

-The disc must be free of defects (12). Do not use defective cutting discs.

Always tighten the cutting disc mounting bolt to a torque of 30 Nm. Otherwise, the cutting disc can twist.

-Before starting the cutting disc, make sure you have a steady footing.

-Put the Power Cut into operation only as described in this instruction manual (13). Always place your left foot in the rear handle and grasptheotherhandlefirmly(withthumbandfingers).Otherstarting methods are not allowed.

-When starting the Power Cut it must be well supported and securely held. The cutting disc must not be touching anything.

-If the cutting disc is new, test it by running it at least 60 seconds at topspeed.Whendoingthis,makesurethatnopersonsorbodyparts are in the extended swing range of the disc, in case it is defective and flies apart.

-When working with the Power Cut always hold it with both hands. Take the back handle with the right hand and the tubular handle with the left hand. Hold the handles tightly with your thumbs facing your fingers.

-CAUTION: When you release the throttle lever the disc will keep spinning for a short period of time (free wheeling effect).

-Continuously ensure that you have a safe footing.

-Hold the Power Cut such that you will not breathe in the exhaust gas.Donotworkinclosedroomsorindeepholesorditches(danger of poisoning by fumes).

-Switch off the Power Cut immediately if you observe any changes in its operating behavior.

-Switch off the engine before inspecting the V-belt tension or tighteningit,replacingthecuttingwheel,repositioningthecutter attachment (side or middle position) or eliminating faults (14).

-Turn off the engine immediately and check the disc if you hear or feel any change in cutting behaviour.

-Turn off the Power Cut when taking a break or stopping work (14). Place the unit in such a way that the disc is not touching anything and cannot endanger anyone.

-DonotputtheoverheatedPowerCutindrygrassoronanyinflammable objects. The muffler is very hot (danger of fire).

-IMPORTANT:Afterwetcutting,firstturnoffthewaterfeedandthen letthediscrunatleast30seconds,toflingofftheremainingwater and prevent corrosion.

10

min. 5 m

11

12

13

● Maintenance ● Refuelling

● Changing cutoff discs

● Repositioning the cutting attachment

● Stopping work

● Transport

● Putting out of function

14

Kickback and lock in

-When working with the Power Cut there is a danger of kickback and lock in.

-Kickback occurs when the top of the cutting disc is used for cutting (15).

-This causes the Power Cut to be thrown back toward the user with great force and out of control. Risk of injury!

To prevent kickback, observe the following:

-Never cut with the section of the cutting disc shown in figure 15.

Be especially careful when reinserting the disc into cuts that have already been started!

-Lock in occurs when the cut narrows (crack, or workpiece under stress).

-This causes the Power Cut to suddenly jump forward, out of control and with great force. Risk of injury!

To prevent lock in, observe the following:

-When reinserting the disc into previous cuts, have the Power Cut running at top speed. Always cut at top speed.

-Always support the workpiece so that the cut is under tension (16), so that the cut does not press together and jam the cutting disc as it proceeds through the material.

-When starting a cut, apply the disc to the workpiece with care. Do not just shove it into the material.

-Never cut more than one piece at a time! When cutting, make sure that no other workpiece comes into contact.

Working behavior / Method of working

-Before starting work, check the work area for any hazards

(electrical wires, inflammable substances). Clearly mark the work area (for example with warning signs or by cordoning off the area).

-When working withthe PowerCut holdit firmly by thefrontand rear handles. Never leave the Power Cut unattended!

-Use the Power Cut at high speed as far as possible (see “Technical Data”).

-Only use the Power Cut during good light and visibility periods. Be aware of slippery or wet areas, and of ice and snow (risk of slipping).

-Never work on unstable surfaces. Make sure that there are no obstacles in the working area, risk of stumbling. Always ensure that you have a safe footing.

-Never cut above your shoulder height (17).

-Never stand on a ladder to cut (17).

-Never use the Power Cut while standing on scaffolding.

-Do not lean over too far when working. When putting down and picking up the Power Cut, do not bend over from the waist, but instead bend in the knees. Save your back!

-Guide the Power Cut in such a way that no part of your body is within the extended swing range of the disc (18).

-Use cutting discs only for the materials for which they are designed!

-Use cutting discs only for the materials for which they are designed. Do not use the Power Cut to lift up and shovel away pieces of material and other objects.

Important! Before cutting, remove all foreign objects, such as rocks, gravel, nails etc. from the cutting area. Otherwise, such objects can be flung away by the disc with great speed. Injury hazard!

-When cutting workpieces down to length use a firm support.

If necessary, secure the workpiece from slipping, but do not steady it with your foot or allow another person to hold it.

-When cutting round items, always secure them against rotation.

-When guiding the Power Cut by hand, use the side mounting position of the cutter attachment only when actually necessary. Otherwise, always use the central position. This gives the unit a better balance, for reduced operator fatigue.

15

16

17

18

When using synthetic resin cutting discs, always observe the following:

CAUTION:

-Synthetic resin cutting discs can absorb moisture. This moisture can cause the disc to become unbalanced at high speed. This imbalance can cause the disc to break.

-Do not cool resin cutting discs with water or other fluids.

-Do not expose resin cutting discs to high humidity or rain!

Do not use resin cutting discs past their use-by date (expiration date)! The date (quarter and year) is stamped on the disc’s arbor ring.

EXAMPLE: 04 / 2007

This cutting disc can be used through the end of the fourth quarter of 2007, if properly stored and correctly used.

Cutting metals

IMPORTANT!

Always wear approved respiratory protection!

Materials that can release toxic substances may be cut only after notifying the proper authorities and under their supervision or that of a person appointed by them.

CAUTION!

The rapid rotation of the cutting disc heats metal and melts it at the point of contact. Swing the guard as far down as possible (19) in order to direct the stream of sparks forward, away from the operator (fire hazard).

-Determine the cut line, mark the cut and apply the disc to the material at moderate speed, to cut a guide groove before going to top speed and applying more pressure to the Power Cut.

-Keep the disc straight and vertical. Do not tip it, as this can break it.

-The best way to get a good, clean cut is to pull or move the Power Cut back and forth. Do not simply press the disc into the material.

-Thick round stock is best cut in stages (20).

-Thin tubing and pipes can be cut with a simple downward cut.

-Cut large diameter pipes as for round stock. To prevent tipping and for better control, do not let the disc sink too deeply into the material. Instead, always cut shallow around the whole piece.

-Worn discs have a smaller diameter than new discs, so that at the same engine speed they have a lower effective circumferential speed and therefore do not cut as well.

-Cut I beams and L bars in steps; see Figure 21.

-Cut bands and plates like pipes: along the wide side with a long cut.

-When cutting material under stress (supported material or material in structures), always make a notch in the thrust (pressure) side, and then cut from the tension side, so that the disc does not lock in. Secure cutoff material from falling!

CAUTION!

If there is a chance that the material is under stress, be prepared for it to kick back. Make sure you can get out of the way if you have to!

Be particularly careful in scrap metal yards, junkyards, at accident sites, and with haphazard piles of material. Precariously balanced pieces or pieces under stress can act in unpredictable ways, and may slide, jump out, or burst. Secure cutoff material from falling! Always exercise extreme caution and use only equipment that is in perfect working order.

Observe the accident prevention rules and regulations of your employer and/or insurance organization.

Cutting masonry and concrete

IMPORTANT!

Always wear approved respiratory protection!

Asbestos and other materials that can release toxic substancesmaybecutonlyafternotifyingtheproperauthorities and under their supervision or that of a person appointed by them. When cutting prestressed and reinforced concrete piles, follow the instructions and standards of the responsible authorities or the builder of the structural member. Reinforcement rods must be cut in the prescribed sequence and in accordance with applicable safety regulations.

NOTE:

Mortar,stone,andconcretedeveloplargequantitiesofdustduring cutting. To increase the lifetime of the cutting disc (by cooling), to improve visibility, and to avoid excessive dust creation, we strongly recommend wet cutting instead of dry cutting.

19

20

21

In wet cutting, the disc is wetted at an equal rate on both sides by a trickle of water. DOLMAR offers the right accessories for all wet cutting applications (see also "SPECIAL ACCESSORIES").

-Remove foreign objects such as sand, stones and nails found within the working area. Caution: Watch out for electric wires and cables!

The rapid rotation of the cutting disc at the point of contact throws fragments out of the cut groove at high speed. For your safety, swing the protection hood down as far as possible (23), so that material fragments are thrown forward, away from the operator.

-Mark the cut, and then make a groove about 5 mm (just under 1/5") along the entire length of the planned cut. This groove will then guide the Power Cut accurately guring the actual cutoff.

NOTE:

For long, straight cuts we recommend using a trolley (24, see also "SPECIAL ACCESSORIES"). This makes it much easier to guide the unit straight.

-Perform the cut with a steady back and forth motion.

-When cutting slabs to size, you need not cut through the entire material thickness (creating unnecessary dust). Instead, simply make a shallow groove, and then knock off the excess material cleanly on a flat surface (25).

CAREFUL!

When cutting into lengths, cutting through material, making cutouts, etc., always make sure to plan the direction and sequence of cuts in such a way that the disc does not get jammed by the cut off piece, and that no persons can be injured by falling pieces.

Transport and storage

-Always turn off the Power Cut when transporting it or moving it from place to place on a site (26).

-Never carry or move the unit with the engine on or the disc moving!

-Carry the unit only by the tubular (middle) handle with the cutting disc pointing behind you (26). Avoid touching the exhaust muffler (burn hazard!)

-When moving the Power Cut over longer distances, use a wheelbarrow or wagon.

-When transporting the Power Cut in a vehicle, make sure it is securely positioned in such a way that no fuel can leak out. Always remove the cutting disc before transporting the unit in a vehicle.

-The Power Cut should be stored safely in a dry place. It must not be left outdoors! Always dismount the cutting disc before storage. Keep the Power Cut away from children.

-Before long term storage and before shipping the Power Cut, follow the instructions in the chapter on "Periodic care and maintenance". ALWAYS empty the fuel tank and run the carburetor dry.

-When putting cutting discs in storage, be careful to:

Clean and dry them well. CAUTION: Do NOT clean synthetic resin cutting discs with water or other fluids!

Store them lying down flat.

Avoid dampness, freezing temperatures, direct sunshine, high temperatures and temperature fluctuations, as these can cause breakage and splintering.

Before re-using a resin cutting disc, make sure of the use-by (expiration) date (quarter and year, stamped on the arbor ring). If this date has been exceeded, do NOT use the cutting disc.

-Always check new cutting discs or cutting discs that have been in storage to make sure that they are free of defects and before the first cut test-run the tool at top speed for at least 60 seconds. Keep body parts and people well away out of range of the direction of the cutting disc during this test.

23

24

25

26

10

Maintenance

-Before performing maintenance work switch off the Power Cut (27) and pull out the plug cap.

-Always check the Power Cut before using it to make sure that it is in good working order. In particular, make sure that the cutting disc is properly mounted. Make sure that the cutting wheel is undamaged and suitable for the job it will be used for.

-Operate the Power Cut only at a low noise and emission level. For this ensure the carburetor is adjusted correctly.

-Clean the Power Cut regularly.

-Check the fuel tank cap regularly for good sealing.

Observe the accident prevention instructions issued by trade associations and insurance companies. NEVER make any modifications to the Power Cut! You will only be putting your own safety at risk!

Perform only the maintenance and repair works described in the instruction manual. All other work must be carried out by DOLMAR Service.

Use only original DOLMAR spares and accessories.

The use of non DOLMAR spares, accessories, or cutting discs increases the risk of accident. We cannot accept any responsibility for accidents or damage occurring in association with the use of cutting discs or accessories other than original DOLMAR.

First aid

For the event of a possible accident, please make sure that a firstaidkitisalwaysimmediatelyavailablecloseby.Immediately replace any items used from the first aid box.

When calling for help, give the following information:

-Place of the accident

-What happened

-Number of injured people

-Kind of injuries

-Your name!

NOTE

Individuals with poor circulation who are exposed to excessive vibration may experience injury to blood vessels or the nervous system.

Vibration may cause the following symptoms to occur in the fingers, hands or wrists: ”Falling asleep” (numbness), tingling, pain, stabbing sensation, alteration of skin colour or of the skin. If any of these symptoms occur, see a physician!

Disposal and environmental protection

Be mindful of the environment!

Dispose of worn-out or defective cutting discs in accordance with your local disposal regulations. To protect unusable cutting discs from misuse, destroy them before disposal.

When the Power Cut is worn out or damaged beyond repair, have it disposed of or recycled in an environmentally sound manner. If necessary, consult your local authorities.

27

SERVICE

28

29

11

Technical data

 

 

 

 

 

 

 

 

 

PC-6430

PC-6435

PC-7330

PC-7335

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Displacement

cu in (cm3)

3.9

(64)

4.5

(73)

 

 

Bore

in

(mm)

1.85

(47)

1.97

(50)

 

 

Stroke

in

(mm)

1.46

(37)

1.46

(37)

 

 

Max. power

hp (kW)

4.4

(3.2)

5.6

(4.2)

 

 

Max. torque

Nm

4.0

5.0

 

 

Idling speed

1/min

2,500

2,500

 

 

Clutch engagement speed

1/min

3,800

3,800

 

 

Engine speed limitation

1/min

9,350 ± 145

9,350± 145

 

 

Max. spindle speed

1/min

4,300

4,300

 

 

Sound pressure level at the operators ear

dB (A)

97

104

 

 

Sound pressure level at the bystander’s position (50 ft)

dB (A)

84

86

 

 

Vibration acceleration ah,w per EN 1454

m/s2

6 / 5

7 / 6

 

 

- Tubular handle (idle/rated spindle speed)

 

 

 

- Rear handle (idle/rated spindle speed)

m/s2

8 / 6

8 / 7

 

 

Carburetor (diaphragm carburetor)

Type

 

TILLOTSON HS-273 A

 

 

 

Ignition system (with speed limitation)

Type

 

electronic

 

 

 

Spark plug

Type

NGK BPMR 7A / BOSCH WSR 6F / CHAMPION RCJ 6Y

 

 

Electrode gap

in

(mm)

.020

(0.5)

.020

(0.5)

 

 

Fuel consumption at max. load per ISO 8893

kg/h

1.65

2.1

 

 

Specific consumption at max. load per ISO 8893

g/kWh

500

500

 

 

Fuel tank capacity

fl oz (l)

37

(1.1)

37

(1.1)

 

 

Mixture ratio (fuel/two-stroke oil)

 

 

100:1

100:1

 

 

 

- when using DOLMAR HP 100 high-performance oil

 

 

 

 

 

- when using DOLMAR oil

 

 

50:1

50:1

 

 

Cutting disc for 80 m/sec. 2)

in

 

12" / 0.8" / 0.2" 3)

14" / 0.8" / 0.2" 3)

12" / 0.8" / 0.2" 3)

14" / 0.8" / 0.2" 3)

 

Cutting disc for 80 m/sec. 2) 4)

in

 

 

14" / 1" / 0.2" 3)

 

14" / 1" / 0.2"

3)

 

Arbor diameter

in

 

0.8"

0.8" / 1.0"

0.8"

0.8" / 1.0"

 

V belt

no.

965 300 470

965 300 470

 

 

Overall weight (tanks empty, without cutting disc)

lb

 

21.38

21.82

21.6

22.04

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

PC-8135

 

 

PC-8140

 

 

 

 

 

 

 

 

 

 

 

Displacement

cu in (cm3)

4.9

(81)

 

 

4.9

(81)

 

Bore

in

(mm)

2.05

(52)

 

 

2.05

(52)

 

Stroke

in

(mm)

1.49

(38)

 

 

1.49

(38)

 

Max. power

hp (kW)

6.2

(4.5)

 

 

6.2 (4.5)

 

Max. torque

Nm

5.2

 

 

5.2

 

Idling speed

1/min

2,500

 

 

2,500

 

Clutch engagement speed

1/min

3,800

 

 

3,800

 

Engine speed limitation

1/min

9,350 ± 145

 

 

9,350 ± 145

 

Max. spindle speed

1/min

4,300

 

 

3,750

 

Sound pressure level at the operators ear

dB (A)

100

 

 

100

 

Sound pressure level at the bystander’s position (50 ft)

dB (A)

79

 

 

79

 

Vibration acceleration ah,w per EN 1454

m/s2

5.6 / 6.3

 

 

5.6 / 6.3

 

- Tubular handle (idle/rated spindle speed)

 

 

 

 

- Rear handle (idle/rated spindle speed)

m/s2

8.8 / 6.0

 

 

8.8 / 6.0

 

Carburetor (diaphragm carburetor)

Type

 

WALBRO WJ-105

 

 

Ignition system (with speed limitation)

Type

 

 

electronic

 

 

 

Spark plug

Type

NGK BPMR 7A / BOSCH WSR 6F / CHAMPION RCJ 6Y

 

Electrode gap

in

(mm)

.020

(0.5)

 

 

.020

(0.5)

 

Fuel consumption at max. load per ISO 8893

kg/h

2.3

 

 

2.3

 

Specific consumption at max. load per ISO 8893

g/kWh

500

 

 

500

 

Fuel tank capacity

fl oz (l)

37

(1.1)

 

 

37

(1.1)

 

Mixture ratio (fuel/two-stroke oil)

 

 

100:1

 

 

100:1

 

 

- when using DOLMAR HP 100 high-performance oil

 

 

 

 

 

 

- when using DOLMAR oil

 

 

50:1

 

 

50:1

 

Cutting disc for 80 m/sec. 2)

in

 

14" / 0.8" / 0.2" 3)

 

16" / 0.8" / 0.2" 3)

 

Cutting disc for 80 m/sec. 2) 4)

in

 

14" / 1.0" / 0.2"

3)

 

16" / 1.0" / 0.2" 3)

 

Arbor diameter

in

 

0.8"

(1.0") 4)

 

 

0.8" (1.0") 4)

 

V belt

no.

965 300 490

 

 

965 300 480

 

Overall weight (tanks empty, without cutting disc)

lb

 

22.05

 

 

23.37

2) Circumference speed at max. engine speed

3) Outside diameter / arbor hole / thickness

4) Country-specific

12

Denomination of components (Illustration shows model PC-7335)

3

4

5

6

7

2

26

 

1

8

 

 

9

13

12

11

10

15

16

 

 

 

14

 

 

25

 

 

17

 

 

24

 

 

18

 

 

23

 

 

19

 

PC-7335

Identification plate (12)

 

 

20

 

 

 

 

 

 

Indicate when ordering spare parts

 

 

 

DOLMAR GmbH, 22045 Hamburg, Germany

Serial number

 

22

21

 

394.100. 256 Typ 394

Year of manufacture

 

 

 

 

 

 

 

 

1

Handle

 

14

Decompression valve

2

Filter cover for air filter and spark plug cap

15

Starter grip

 

3

Cover lock

 

16

Air intake

 

4

Tubular handle

17

Combination Start/Stop (I/O) switch, choke

5

Muffler

 

18

Stop knob for halfway throttle

6

Protection hood

19

Safety locking button

 

7

Grip

 

20

Throttle lever

 

8

V-belt tension adjusting screw

21

Tank cap (fuel)

 

9

Retaining nuts

22

Starter housing with starter

10

Stand

 

23

Cutting disc

 

11

Carburetor adjustment opening

24

Disc bolt

 

12

Identification plate

25

Spring washer

 

13

Fuel tank with handle

26

Hold opening

 

13

Putting into operation

CAUTION:

Always turn off the engine and pull off the spark plug cap before doing any work on the Power Cut! Always wear protective gloves!

CAUTION:

Start the Power Cut only after complete assembly and inspection.

For the the following work, use the assembly tools included with delivery:

1. 13/19 AF combination wrench

2. Allen key

3. Carburetor adjustment screwdriver

4. Adapter ring (not in the general delivery inventory)

Place the Power Cut on a stable surface and carry out the following assembly steps:

Only for models PC-8135 and 8140

No air filter is installed!

Before operation, insert an oiled foam filter (pre-filter), as shown in the adjacent illustration! To do this, take off the filter cover (see the chapter on Cleaning / changing the air filter).

Sequence

Mounting the cutting disc

Inspect the disc for damage.

See SAFETY INSTRUCTIONS, Page 7.

Unscrew screw (9) and remove the spring washer (8). Place the cutting disc (5) on the arbour (7).

Hinweis: The arbor hole of the cutting disc must be an exact fit with the arbor or shaft. If the arbor hole is larger, it must be fitted with an adapter ring (*).

Make sure the cutting disc is installed so it turns in the right direction, if a direction is marked on the disc.

Place the spring washer (8) on the arbour and insert the screw (9) and tighten by hand.

Turn the disc slowly until the stop hole of the V-belt pulley is visible in the cutting arm cover (10).

Insert the Allen key (2) as far as it will go. The shaft is now blocked.

Tighten the screw with the combination wrench (1)

NOTE: Tighten the screw firmly (30 ± 2 Nm), as otherwise the cutting wheel may slip during cutting.

14

Tightening the V-belt / Checking V-belt tension

IMPORTANT:

Exact V belt tension is essential for maximum cutting performance with minimum fuel consumption. Improper V belt tension will result in premature wear to the V belt and V belt wheel or damage to the clutch bearing.

If the Power Cut is new or the V-belt has been replaced, retighten the V-belt after the first hour of operation!

NOTE: The two fastening nuts (11) must be loosened before tightening the V-belt or checking the tension.

To increase the belt tension, turn the tightening screw (12) to the right (clockwise) with the combination wrench included with the Power Cut.

The belt tension is correctly adjusted when the nut (13) is centred on the mark (14).

IMPORTANT:

After tightening/inspection, make certain to tighten the fastening nuts (11) (30 ± 2 Nm).

Installing the pressure water system

Not in the general scope of delivery. Country-specific!

CAUTION: Before doing any work on the Power Cut, always switch off the engine and disconnect

the spark plug cap!

NOTE: When using a protective hood for a maximum disk diameter of 300 mm (12"), always shorten hose (15) to 180 mm (7").

To do this unscrew sleeve (16) and carefully pull tube (15) off coupling (17) and cut to 180 mm. Then push the tube end back over the coupling and tighten the sleeve all the way.

-Install the water connection as shown in figure. Push clamp

(22) around the front grip (23) and fasten with the bolt and square nut.

-Pull the quick-release coupling (24) from the water connection and connect it to the 1/2" supply line (18).

-Remove the cutting disk (see instruction manual).

-Tube routing with the cutting assembly in the middle position, see figure.

-Tube routing with the cutting assembly in the outside position, see figure.

-Insert the nozzles (19) through the protective hood (20) from the inside and put on couplings (17). Screw on and tighten the coupling caps (21).

IMPORTANT:

To avoid bending the tubes, be sure to position the couplings (17) in accordance with figures as appropriate.

-Install the cutting disc (see instruction manual).

-Connect the quick-release coupling (24) to the supply tube.

NOTE:

The water flow rate can be precisely adjusted with valve (25).

15

 

16

17

21

21

17

19

 

 

20

18 *

15

23

22

25

24

Fuels

Caution:

The Power Cut uses mineral-oil products (gasoline and oil).

Be especially careful when handling gasoline.

Do not smoke. Do not allow gasoline to come near flames, sparks or fire (explosion hazard).

Fuel mixture

The Power Cut is powered by a high performance two stroke engine. It runs on a mixture of gasoline and two-stroke engine oil.

The engine is designed for unleaded regular gasoline with a min. octane value of 91 ROZ. In case no such fuel is available, you can use fuel with a higher octane value. This will not affect the engine.

In order to obtain an optimum engine output and to protect your health and the environment use unleaded fuel only. Gasoline which contens alcohol should not used in DOLMAR products.

To lubricate the engine, use a two-stroke engine oil (quality grade JASO FC or ISO EGD), which is added to the fuel. The engine is designed for the use of DOLMAR HP 100 high-performance two-stroke engine oil at a mixture ratio of only 100:1 to protect the environment. In addition, this ensures a long service life and reliable operation with minimum exhaust emissions.

 

 

 

 

 

 

Gasoline

100:1

50:1

 

 

 

 

 

 

 

 

 

 

 

 

+

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

1.0

Us-gal.

(3.7 l)

1.25 floz. (37 cm3)

2.5 floz.

(75 cm3)

2.5

Us-gal.

(9.4 l)

3.2 floz. (94 cm3)

6.4 floz.

(189 cm3)

5.0

Us-gal. (18.9 l)

6.4 floz. (189 cm3)

12.8 floz. (378 cm3)

The correct mixture ratio:

100:1 WhenusingDOLMARHP100high-performance two-stroke engine oil, i. e. 100 parts gasoline to 1 part oil.

50:1 When using DOLMAR high-performance twostroke engine oil, i. e. 50 parts gasoline to 1 part oil.

16

oil is available in the following sizes to suit your individual

requirements:

 

 

50 ml

order number

980 008 105

0.5 l

order number

980 008 113

DOLMAR HP 100 high-performance two-stroke engine

DOLMAR high-performance two-stroke engine oil (50:1) is

available in the following sizes to suit your individual require-

ments:

 

 

100 ml

order number 980 008 106

1 l

order number

980 008 112

5 l

order number

980 008 118

NOTE: Forpreparingthefuel-oilmixturefirstmixtheentireoil quantity with half of the fuel required, then add the remaining fuel. Shake the finished mixture thoroughly before pouring it into the Power Cut tank.

Caution: Open the tank cap carefully, as pressure might have built up inside!

It is not wise to add more engine oil than specified to ensure safe operation. This will only result in a higher production of combustion residues which will pollute the environment and clog the exhaust channel in the cylinder as well as the muffler. In addition, fuel consumption will rise and performance will decrease.

The Storage of Fuel

Fuels have a limited storage life. Fuel and fuel mixtures age. Therefore fuel and fuel mixtures, which have been stored for too long, can cause starting problems. Purchase only that amount of fuel, which will be consumed over the next few months.

Store fuel safely in a dry place in approved containers only.

AVOID SKIN AND EYE CONTACT

Mineral oil products degrease your skin. If your skin comes in contact with these substances repeatedly and for an extended period of time, it will dry out. Various skin deseases may result. In addition, allergic reactions are known to occur.

Eyes can be irritated by contact with oil. If oil comes into your eyes, immediately wash them with clear water.

If your eyes are still irritated, see a doctor immediately!

Refuelling IMPORTANT:

FOLLOW THE SAFETY PRECAUTIONS!

Be careful and cautious when handling fuels. The engine must be turned off and cooled down!

Carefully clean the area around the fuel tank filler neck to keep dirt from getting in the tank.

Place the unit on its side on an even surface.

Unscrew the tank cap and fill tank with fuel mixture. Take care to avoid spilling.

Screw the tank cap back on hand-tight.

Clean screw cap and tank after refuelling. Never start or operate the Power Cut in the same place as it was fuelled!

Fuel mixture

If fuel gets on your clothing, change clothes immediately.

17

Starting the engine

if

necessary

This model is fitted with a semiautomatic decompression valve

(1) to make starting easier. Depressing it reduces the force needed for compression, so little force is needed to accelerate the engine to its starting speed.

The high pressure in the combustion chamber after the first ignition automatically closes the decompression valve (button pops out).

CAUTION:

 

Observe the SAFETY INSTRUCTIONS on page 5 and 6!

 

Start the Power Cut only after complete assembly and

 

inspection!

 

Move at least 3m away from the place where you fuelled

3 meters

the Power Cut.

Make sure you have a good footing, and place the Power

 

Cut on the ground in such a way that the cutting disc is

 

not touching anything.

 

Move the protective hood (3) into the proper position for the work you intend to do (see illustration).

Grasp the grip (2). The hood (3) can swing in both ways within its range of motion.

Caution:

Always make sure that the straight outer edge of the impact plate (4) and the edge of the hood are parallel (see arrows).

If this is not the case, take the tool to a service centre.

Cold starting

Move the combination switch (6) up (choke position).

Grasp handle (hand pressure actuates the grip throttle lever lock (8)).

Push the throttle (9) in all the way and hold it.

Press the throttle lock (7) and release the throttle (9) (the throttle lock will hold the throttle at half-throttle position).

NOTE: If the Power Cut is in a trolley, bring the control lever to the third or fourth detent.

Depress decompression valve (5).

18

Grasp the tubular handle firmly with one hand and press the

Power Cut against the ground.

Place the tip of your left foot in the rear handle.

Pull the starter cable strong and rapidly until you hear the first audible ignition.

Caution: Do not pull out the starter cable more than approx. 50 cm, and lead it back by hand.

Depress decompression valve (5) again.

Put the combination switch (6) in position “I”.

Keep pulling the starter cable until the engine catches.

As soon as the engine is running, press the throttle (9) to release the half throttle lock (7), allowing the engine to idle.

Warm-starting

As described under ”Cold starting”, except without putting the combination switch (6) in choke position.

Stopping the engine

Push the combination switch (10) down to position .

19

Adjusting

the carburetor

NOTE: The grinding parts are equipped with an electronic ignition to limit the speed. The carburetor also has a fixed

jet which cannot be adjusted.

At the factory the idling speed has been set to approx. 2500 rpm, but the running-in process of a new engine may require slight readjustment of the idling speed.

For correct adjustment of the idling speed the following steps must be carried out:

Start the engine and run it until it is warm (about 3 - 5 minutes).

Adjust the carburetor with the screwdriver (1, Order No. 944 340 001) included with the Power Cut. It has a lug that helps with adjustment.

Readjust the idling speed.

If the cut-off disc is still turning when the engine is running, unscrew the adjusting screw of the throttle valve (2) until the cut-off disc is no longer turning. When the engine is left running at idling speed, loosen the screw a little.

Switch off the engine

20

MAINTENANCE

CAUTION:

Before doing any work on the Power Cut turn off the engine, remove the cutting disc, pull the plug cap off the spark plug and wear protective gloves!

CAUTION:

Start the Power Cut only after complete assembly and inspection.

IMPORTANT:

Because many of the parts and assemblies not mentioned in this Instruction Manual are vital to the safety of the unit, and because all parts are subject to a certain amount of wear and tear, it is important for your own safety that you have the unit checked and maintained regularly by a DOLMAR service center.

SERVICE

IMPORTANT:

Ifthecuttingwheelbreaksduringcutting,thePower Cut must be repaired by a DOLMAR service centre before being used again!

Changing the V-belt

Loosen nuts (3).

Loosen the tightening screw (1) (counter-clockwise) until the end of the screw (2) is visible in the gap.

Loosen and unscrew the screw (detail X, only for PC-8140). Unscrew the nuts (3) and remove the cover (4).

Remove the screws (5) and (7) and remove the side piece (6).

NOTE: Screw (5) is longer than screws (7). Make sure to put them back in the right places during reas- sembly!

Unscrew the screws (8) and remove the crankcase housing cover (9).

Remove the old belt (10) or belt pieces.

NOTE: The illustration shows the V-belt for models PC-6430 - 7335).

Clean out the inside of the drive arm with a brush. Put in a new V-belt.

NOTE:

Reassemble the crankcase housing cover (9), side piece (6) and cover (4) in the reverse order.

To tighten the V-belt see ”Tightening the V-belt / Checking

V-belt tension”.

21

+ 47 hidden pages