Page 1
Installation, Operation
& Maintenance Manual
Portable Room Air Conditioner
PS-81B
PS-101B
Thank you for purchasing our Portable Air Conditioner.
Before using your air conditioner, please read this instruction
manual carefully and keep it for future reference.
READ AND SAVE THESE INSTRUCTIONS!
517.787.2100 • www.marsdelivers.com
Page 2
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Contents
Preparation ..................................................................................................................................... 3
Safety Precautions ......................................................................................................................... 4
Cautions ......................................................................................................................................... 5
Installation ...................................................................................................................................... 6
Operation ....................................................................................................................................... 12
Maintenance .................................................................................................................................. 16
Fault Diagnosis .............................................................................................................................. 17
Design and Compliance Notes ...................................................................................................... 18
European Disposal ........................................................................................................................ 19
2
Page 3
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Preparation
Control panel remote
Signal receptor
Horizontal louver control
lever (adjust manually)
vertical louver control
lever (adjust manually)
panel
F ront
Caster
Handle
(both sides)
Air filter
(behind the grill)
Upper air intake
Drain outlet
Air outlet
Lower air intake
Bottom tray
drain outlet
R e ar
3
Page 4
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
circuit.
immediately. Visually inspect the unit to
Safety Precautions
Please read through these instructions before
you start the installation process. Improper
installation can cause damage to the unit,
your personal property, and also poses a
personal safety hazard.
• Installation must be performed according
to the installation instructions. Improper
installation can cause water leakage,
electrical shock, or fire.
• Use only the included accessories and
parts, and specified tools for the
installation. Using non-standard parts can
cause water leakage, electrical shock, fire,
and injury or property damage.
• Make sure that the outlet you are using is
grounded and has the appropriate voltage.
The power cord is equipped with a threeprong grounding plug to protect against
shock. Voltage information can be found
on the side of the unit, behind the grille.
• Install the unit on a flat, sturdy surface.
Failure to do so could result in damage or
excessive noise and vibration.
• The unit must be kept free from
obstruction to ensure proper function and
to mitigate safety hazards.
• DO NOT install the unit in a location
that may be exposed to combustible
gas, as this could cause fire.
• The unit has wheels to facilitate
moving. Make sure not to use the
wheels on thick carpet or to roll over
objects, as these could cause tripping.
• DO NOT operate a unit that has been
dropped or damaged.
• The unit must be kept free from
obstruction to ensure proper function.
• DO NOT allow children to play with the
air conditioner. Children must be
supervised around the unit at all times.
• If the air conditioner is knocked over
during use, turn off the unit and unplug
it from the main power supply
ensure there is no damage. If you
suspect the unit has been damaged,
contact a technician or customer
service for assistance.
• In a thunderstorm, the power must be
cut off to avoid damage to the machine
due to lightning.
• DO NOT modify the length of the power
cord or use an extension cord to power the
unit. DO NOT share a single outlet with
other electrical appliances. Improper
power supply can cause fire or electrical
shock.
• DO NOT install your air conditioner in a
wet room such as a bathroom or laundry
room. Too much exposure to water can
cause electrical components to short
4
Page 5
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
the unit, it may cause fire.
Cautions
• This appliance can be used by children
from 8 years and above and people with
reduced physical, sensory or mental
capabilities or lack of experience and
knowledge if they have been given
supervision or instructions concerning
use of the appliance in a safe way and
understand the hazards involved.
Children shall not play with the appliance.
Cleaning and user maintenance shall not
be made by children without supervision.
(applicable for the European Countries)
• This appliance is not intended for use by
persons (including children) with reduced
physical, sensory or mental capabilities
or lack of experience and knowledge,
unless they have been given supervision
or instruction concerning use of the
appliance by a person responsible for
their safety. (applicable for other
countries except European Countries)
• Children should be supervised to ensure
that they do not play with the appliance.
• If the supply cord is damaged, it must be
replaced by the manufacturer, its service
agent or similarly qualified persons in
order to avoid a hazard.
• Do not run the cord under carpeting. Do
not cover cord with throw rugs, runners,
or similar coverings. Do not route cord
under furniture or appliances. Arrange
cord away from traffic area and where it
will not be tripped over.
• Do not operate unit with a damaged
cord or plug. Discard unit or return to an
authorized service facility for
examination and/or repair.
• To reduce the risk of fire or electric
shock, do not use this fan with any
solid-state speed control device.
• The appliance shall be installed in
accordance with national wiring
regulations.
• Contact the authorized service
technician for repair or maintenance of
this unit.
• Contact the authorized installer for for
installation of this unit.
• When there are wide differences
between 'USER'S MANUAL' and
'Remote controller instruction' on
function description, the description on
'USER'S MANUAL' shall prevail.
• Prior to cleaning or other maintenance,
the appliance must be disconnected from
the supply mains.
• Do not install the appliance in a location
that may be exposed to combustible gas.
• If combustible gad accumulates around
• Do not operate your air conditioner in a
wet room such as a bathroom or
laundry room.
5
Page 6
Choosing the Right Location
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Installation
Note About Fluorinated Gases
•
This air-conditioning unit is a
hermetically sealed unit that
contains fluorinated gases. For
specific information on the type of
gas and the amount, please refer
to the relevant label on the unit
itself.
•
Installation, service, maintenance
and repair of this unit must be
performed by a certified technician.
Your installation location should meet the
following requirements:
Make sure that you install your unit
•
on an even surface to minimize noise
and vibration.
•
The unit must be installed near a
grounded plug, and the Collection
Tray Drain (found on the back of the
unit) must be accessible.
•
The unit should be located at least
30cm (12”) from the nearest wall to
ensure proper air conditioning.
•
DO NOT cover the Intakes, Outlets
or Remote Signal Receptor of the
unit, as this could cause damage to
the unit.
•
Product uninstallation and
recycling must be performed by a
certified technician.
•
If the system has a leak-detection
system installed, it must be
checked for leaks at least every 12
months.
• When the unit is checked for leaks,
proper record-keeping of all
checks is strongly recommended.
NOTE:
All the illustrations in the manual are for
explanation purpose only. Your
machine may be slightly different. The
actual shape shall prevail. The unit can
be controlled by the unit control panel
alone or with the remote controller. This
manual does not include Remote
Controller Operations, see the
<<Remote Controller Instruction>>
packed with the unit for details.
6
Page 7
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Installation
Tools Needed
• Medium Philips screwdriver
• Tape measure or ruler
• Knife or scissors
• Saw (optional, to shorten window adaptor for narrow
windows)
Accessories
Your Window Installation Kit fits windows 67.5-123cm(26.5-48”)
and can be shortened for smaller windows.
Part
Description
Unit Adaptor
Exhaust Hose
Window Slider Adaptor
Bolt
Window Slider A
Window Slider B
Foam Seal A (Adhesive)
Foam Seal B (Adhesive)
Foam Seal C (Non-adhesive)
Security Bracket and 2 Screws
Drain Hose
MODE
SWING
TURBO
FOLLOW ME
SLEEP
RESET
LOCK
LED
CLOCK
OFF
FAN SPEED
ON
AUTO
CLOCK
CANCEL
SET TEMP.
F
C
TIMER
FAN
Remote Controller and
Batteries (For remote
Quantity
1 pc
1 pc
1 pc
1 pc
1 pc
1 pc
2 pc
2 pc
1 pc
1 set
1 pc
1 set
control models only)
7
Page 8
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Installation
Window Installation Kit
Step One: Preparing the Exhaust Hose assembly
Press the exhaust hose into the window slider adaptor and unit adaptor, clamp with
elastic buckles of the adaptors.
Exhaust hose
Unit adaptor Window slider
adaptor
Exhaust hose
assembly
Step Two: Install the Exhaust hose assembly to the unit
Push the Exhaust hose into the airoutlet opening of the unit along the arrow direction.
Step Three: Preparing the Adjustable Window Slider
1. Depending on the size of your window, adjust the size of the window slider.
2. If the length of the window requires two window sliders, use the bolt to fasten the
window sliders once they are adjusted to the proper length.
Window slider A Window slider B
Bolt
8
Page 9
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Installation
Note: Once the Exhaust Hose assembly and Adjustable Window Slider are prepared,
choose from one of the following two installation methods.
Type 1: Hung Window Installation
Foam seal B
(Adhesive type-shorter)
Foam seal A
(Adhesive type)
Cut the adhesive foam seal A and
B strips to the proper lengths, and
attach them to the window sash
and frame as shown.
Foam seal C
(Non-adhesive type)
Cut the non-adhesive foam seal C
strip to match the width of the
window. Insert the seal between the
glass and the window frame to
prevent air and insects from getting
into the room.
Window slider A
Window slider B
(if required)
Insert the window slider assembly
into the window opening.
Security Bracket
2 Screws
If desired, install the security
bracket with 2 screws as shown.
9
Page 10
Insert the window slider adaptor into the
hole of the window slider.
Type 2: Sliding Window Installation
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Installation
Foam seal B
(Adhesive type-shorter)
Foam seal A
(Adhesive type)
Cut the adhesive foam seal A and B
strips to the proper lengths, and
attach them to the window sash and
frame as shown.
Foam seal C
(Non-adhesive type)
Cut the non-adhesive foam seal C
strip to match the window height.
Insert the foam seal between the
glass and the window frame to
prevent air and insects from getting
into the room.
Window slider B
(if required)
Window slider A
Insert the window slider assembly into
the window opening.
Security
Bracket
2 Screws
If desired, install the security bracket
with 2 screws as shown.
10
Page 11
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Installation
Insert the window slider adaptor into the hole of the window slider.
Note: To ensure proper function, DO NOT overextend or bend the hose. Make sure that
there is no obstacle around the air outlet of the exhaust hose (in the range of 500mm) so
the exhaust system works properly. All the illustrations in this manual are for explanation
purposes only. Your air conditioner may be slightly different. The actual shape shall
prevail.
11
Page 12
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Operation
MODE button
Selects the appropriate operating
mode. Each time you press the button,
a mode is selected in a sequence that
goes from COOL, FAN and DRY. The
mode indicator light illuminates under
the different mode setting.
NOTE: On above modes, the unit
operates the auto fan speed
automatically. You can set fan speed
only by the remote controller on COOL
and FAN modes.
Up (+) and Down (-) buttons
Used to adjust (increasing/decreasing)
temperature settings in 1°C/1°F
increments in a range of 17°C/62°F to
30°C/86°F.
NOTE: The control is capable of
displaying temperature in degrees
Fahrenheit or degrees Celsius. To
convert from one to the other, press
and hold the Up and Down buttons at
the same time for 3 seconds.
Power
indicator light
Timer mode indicator
light (set only by
remote controller)
Power button
Power switch on/off.
LED display
Shows the set temperature while on cool
mode. While on DRY and FAN modes, it
shows the room temperature.
Shows Error codes:
E1-Room temperature sensor error.
E2-Evaporator temperature sensor error.
E4-Display panel communication error.
Shows protection code:
P1-Bottom tray is full–Connect the drain
hose and drain the collected water away.
If protection repeats,call for service.
Note: When one of the above
malfunctions occurs, turn off the unit, and
check for any obstructions. Restart the
unit, if the malfunction is still present, turn
off the unit and unplug the power cord.
Contact the manufacturer or its service
agents or a similar qualified person for
service.
12
Page 13
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Operation
Operation Instructions
COOL operation
• Press the "MODE" button until the
"COOL" indicator light comes on.
• Press the ADJUST buttons "+" or
"-" to select your desired room
temperature. The temperature can
be set within a range of
17°C~30°C/62°F~86°F.
• Press the "FAN SPEED" button on
the remote controller to choose the
fan speed.
DRY operation
• Press the "MODE" button until the
"DRY" indicator light comes on.
• Under this mode, you cannot select
a fan speed or adjust the
temperature. The fan motor
operates at LOW speed.
• Keep windows and doors closed for
the best dehumidifying effect.
• Do not put the duct to window.
FAN operation
• Press the "MODE" button until the
"FAN " indicator light comes on.
• Press the "FAN SPEED" button on
the remote controller to choose the
fan speed. The temperature can
not be adjusted.
• Do not put the duct to window.
Other features
SLEEP/ECO operation
• This feature can be activated
from the remote control ONLY.
To activate SLEEP feature, the
set temperature will increase by
1°C/2°F) in 30 minutes. The set
temperature will then increase
by another 1°C/2°F) after an
additional 30 minutes. This new
temperature will be maintained
for 7 hours before it returns to
the originally selected
temperature. This ends the
Sleep mode and the unit will
continue to operate as originally
programmed.
NOTE: This feature is
unavailable under FAN or DRY
mode.
FOLLOW ME/TEMP SENSING
feature(optional)
• NOTE:This feature can be
activated from the remote
control ONLY. The remote
control serves as a remote
thermostat allowing for the
precise temperature control at
its location. To activate the
Follow Me/Temp Sensing
feature, point the remote control
13
Page 14
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
so will cause damage to the unit.
Operation
towards the unit and press the Follow
Me/Temp Sensing button. The remote
display is actual temperature at its
location. The remote control will send
this signal to the air conditioner in 3
minute intervals until pressing the
Follow Me/Temp Sensing button again.
If the unit does not receive the Follow
Me/Temp Sensing signal during any 7
minute interval, the unit will exit the
Follow Me/Temp Sensing mode.
NOTE: This feature is unavailabe under
FAN or DRY mode.
AUTO-RESTART
If the unit shuts off unexpectedly due to
the power being cut, it will restart with
the previous function setting
automatically when the power resumes.
WAIT 3 MINUTES BEFORE
RESUMING OPERATION
After the unit has stopped, it cannot be
restarted for 3 minutes. This is to
protect the unit. Operation will
automatically start after 3 minutes.
AIR FLOW DIRECTION
ADJUSTMENT
• Ensure the louver is fully opened
under heating operation.
• Keep the louver fully opened
during operation.
Water drainage
• During dehumidifying modes,
remove the drain plug from the
back of the unit, install the drain
connector (5/8" universal female)
with 3/4" hose (locally
purchased). For the models
without drain connector, just
attach the drain hose to the hole.
Place the open end of the hose
directly over the drain area in
your basement floor.
NOTE: When the continuous
drain hose is not used, ensure
that the drain plug and knob are
installed firmly to prevent
leakage.
Remove the
drain plug
Adjust the air flow direction manually:
• The louver can be set to the
desired position manually.
• Do not place any heavy objects or
other loads on the louver, doing
Continuous
drain hose
14
Page 15
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Operation
• When the water level of the bottom
tray reaches a predetermined level,
the unit beeps 8 times, the digital
display area shows "P1". At this
time the air conditioning/
dehumidification process will
immediately stop. However, the fan
motor will continue to operate(this is
normal). Carefully move the unit to a
drain location, remove the bottom
drain plug and let the water drain
away. Reinstall the bottom drain
plug and restart the machine. The
"P1" symbol should disappear. If the
error repeats, call for service.
NOTE: Be sure to reinstall the
bottom drain plug firmly to prevent
leakage before using the unit.
Bottom drain
plug
15
Page 16
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Maintenance
Safety Precautions
• Always unplug the unit before
cleaning or servicing.
• DO NOT use flammable liquids
or chemicals to clean the unit.
• DO NOT wash the unit under
running water. Doing so causes
electrical danger.
• DO NOT operate the machine if
the power supply was damaged
during cleaning. A damaged
power cord must be replaced
with a new cord from the
manufacturer.
Clean the Air Filter
Air filter
(take out)
• The water collection tray should
be drained immediately after P1
error occurs, and before
storage to prevent mold.
• In households with animals, you
will have to periodically wipe
down the grill to prevent blocked
airflow due to animal hair.
Clean the Unit
Clean the unit using a damp, lint-free
cloth and mild detergent. Dry the unit
with a dry lint-free cloth.
Store the unit when not in use
• Drain the unit’s water collection
tray according to the instructions
in the following section.
• Run the appliance on FAN mode
for 12 hours in a warm room to
dry it and prevent mold.
Remove the air filter
Maintenance Tips
• Be sure to clean the air filter
every 2 weeks for optimal
performance.
• Turn off the appliance and
unplug it.
• Clean the air filter according to
the instructions in the previous
section. Reinstall the clean, dry
filter before storing.
• Remove the batteries from the
remote control.
Be sure to store the unit
in a cool, dark place.
Exposure to direct
sunshine or extreme
heat can shorten the
lifespan of the unit.
16
Page 17
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Fault Diagnosis
Please check the machine according to the following form before asking for maintenance:
Problem
Unit does not
turn on when
pressing ON/
OFF button
Unit does not
cool well
Possible Cause
P1 Error Code
In COOL mode: room
temperature is lower
than the set temperature
The air filter is blocked
with dust or animal hair
Exhaust hose is not
connected or is blocked
The unit is low on
refrigerant
Temperature setting is
too high
The windows and doors
in the room are open
Troubleshooting
The Water Collection Tray is full.
Turn off the unit, drain the water
from the Water Collection Tray and
restart the unit.
Reset the temperature
Turn off the unit and clean the
filter according to instructions
Turn off the unit, disconnect the
hose, check for blockage and
reconnect the hose
Call a service technician to inspect
the unit and top off refrigerant
Decrease the set temperature
Make sure all windows and doors
are closed
The room area is too large
There are heat sources
inside the room
The unit is
The ground is not level
noisy and
vibrates too
much
The unit makes
a gurgling
sound
The air filter is blocked
with dust or animal hair
This sound is caused by
the flow of refrigerant
inside the unit
Double-check the cooling area
Remove the heat sources if
possible
Place the unit on a flat, level
surface
Turn off the unit and clean the filter
according to instructions
This is normal
17
Page 18
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
Design and Compliance Notes
Design Notice
In order to ensure the optimal performance of our products, the design specifications
of the unit and remote control are subject to change without prior notice.
Energy Rating Information
The Energy Rating for this unit is based on an installation using an un-extended
exhaust duct without window slider adaptor (as shown in the Installation section of this
manual). At the same time, the unit must be operate on the COOL MODE and HIGH
FAN SPEED by remote controller.
Unit Temperature Range
Mode
Temperature Range
Cool 17-35°C (62-95°F)
Dry 13-35°C (55-95°F)
18
Page 19
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
European Disposal
When using this dehumidifier in the European countries, the following information must be
followed:
DISPOSAL: Do not dispose this product as unsorted municipal waste. Collection of such
waste separately for special treatment is necessary.
It is prohibited to dispose of this appliance in domestic household waste.
For disposal, there are several possibilities:
A) The municipality has established collection systems, where electronic waste can be
disposed of at least free of charge to the user.
B) When buying a new product, the retailer will take back the old product at least free
of charge.
C) The manufacture will take back the old appliance for disposal at least free of charge
to the user.
D) As old products contain valuable resources, they can be sold to scrap metal
dealers.
Wild disposal of waste in forests and landscapes endangers your health when
hazardous substances leak into the ground-water and find their way into the food
chain.
19
Page 20
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
LIMITED EXPRESS WARRANTY
All MARS products are designed for long life and reliable service to help
keep your home comfortable. We’re so confident in the design, quality
components and construction that we back your unit with a strong
warranty coverage as described in this document.
To be eligible for the full term of this Limited Express Warranty,
complete and mail the card below or register your purchase online at
www.marsdelivers.com as soon as possible. Registration must occur
within 90 days of the purchase to qualify for the full term of the coverage.
Don’t forget to read your owner’s manual and ask your installer about
regular maintenance procedures that will help keep your unit operating at
peak efficiency.
LIMITED ONE (1) YEAR PARTS AND LABOR EXPRESS WARRANTY
MARS warrants all parts of the Portable Room Air Conditioner to be free from
defects in workmanship and materials for normal use and maintenance for
one (1) year from the date of purchase by the original consumer. This Express
Limited Warranty applies only when the Portable Room Air Conditioner is
installed and operated per MARS installation and operating instructions for normal
use.
LIMITED FIVE (5) YEAR SEALED SYSTEM WARRANTY
The sealed system only (consisting of compressor, evaporator, condenser and
interconnected tubing) is warranted to be free from defects in workmanship and
materials for normal use and maintenance for four additional years, for a total
of five (5) years from the date of purchase by the original consumer. This five
year warranty applies only when the system is installed and operated per MARS,
installation and operation instructions for normal use.
EXCEPTIONS
The Limited Express Warranty does not cover normal maintenance—MARS
recommends that regular inspection/maintenance be performed at least once a
season and proof of maintenance be kept. Additionally, labor charges (except as
described in paragraph 1 above), diagnostic charges, transportation charges for
replacement parts, replacement of refrigerant or filters, any other service calls/
repairs are not covered by this Limited Warranty. It also does not cover any
portion or component of the system that is not supplied by MARS, regardless of
the cause of failure of such portion or component.
CONDITIONS FOR WARRANTY COVERAGE
• Unit must be operated according to MARS operating instructions included
with the unit and cannot have been subjected to accident, alteration, improper
repair, neglect or misuse, or an act of God (such as a flood)
• Installation must be according to MARS installation instructions
• Serial numbers and/or rating plate have not been altered or removed
• Unit is not operated in a corrosive environment
• Performance cannot be impaired by use of any product not authorized by
MARS, or by any adjustments or adaptations to components
• Damage has not been a result of inadequate wiring or voltage conditions, use
during brown-out conditions, or circuit interruptions
• Air flow around any section of the unit has not been restricted
• Unit is not put to commercial, business, rental or other use or application other
than for residential use
DURATION OF WARRANTY & REGISTRATION
The warranty begins on the date of purchase by the orginal consumer. The
consumer must complete and return the warranty registration card or register
at www.marsdelivers.com within 90 days of purchase. The consumer must
retain a receipted bill of sale as proof of warranty period. Without this proof,
the express warranty begins on the date of shipment from the factory.
REMEDY PROVIDED BY THE LIMITED EXPRESS WARRANTY
The sole remedy under the Limited Warranty is replacement of the defective
part. If replacement parts are required within the period of this warranty,
MARS, replacement parts shall be used; any warranty on the replacement
part(s) shall not affect the applicable original unit warranty. Except during the
first year, labor to diagnose and replace the defective part is not covered by
this Limited Express Warranty. If for any reason the replacement part/product
is no longer available during the warranty period, MARS shall have the right
to allow a credit in the amount of the current suggested retail price of the part/
product instead of providing repair or replacement.
LIMITATION OF LIABILITY
1. There are no other express or implied warranties. MARS makes no
warranty of merchantability. We do not warrant that the unit is suitable
for any particular purpose or can be used in buildings or rooms of
any particular size or condition except as specifically provided in this
document. There are no other warranties, express or implied, which
extend beyond the description in this document.
2. All warranties implied by law are limited in duration to the one-year term
of the Parts Warranty. Your exclusive remedy is limited to the replacement
of defective parts. We will not be liable for any consequential or
incidental damages caused by any defect in this unit.
3. This warranty gives you specific legal rights and you may also have other
rights which vary from state to state. Some states do not allow limitation
on how long an implied warranty lasts or do not allow the exclusion or
limitation of incidental or consequential damages, so the above limitations
or exclusions may not apply to you.
4. No warranties are made for units sold outside the continental United
States and Canada. Your distributor or final seller may provide a warranty
on units sold outside these areas.
5. MARS will not be liable for damages if our performance regarding
warranty resolution is delayed by events beyond our control including
accident, alteration, abuse, war, government restrictions, strikes, fire,
flood, or other acts of God.
HOW TO OBTAIN WARRANTY SERVICE OR PARTS
If you have a warranty claim, contact our North American service provider
at 1-866-557-1865. Have the model number, serial number, and date of
purchase available for this call. Do not return your unit to the store where it
was purchased.
Owner responsibilities are set forth in the
instruction manual—read it carefully.
Please visit www.marsdelivers.com
to register your new product
Portable A/C_WARRANTY_4/2017
KEEP THIS INFORMATION AS A RECORD OF YOUR PURCHASE
PORTABLE AIR CONDITIONER
Model Number Where Purchased
Serial Number Store Location
Date of Purchase Date of Installation
Remember to retain your bill of sale as proof of warranty period.
20
Page 21
Installation, Operation & Maintenance Manual - PS-81B / PS-101B
THIS PAGE INTENTIONALLY LEFT BLANK
21
Page 22
'XHWRRQJRLQJSURGXFWLPSURYHPHQWVVSHFLILFDWLRQVDQGGLPHQVLRQVDUH
VXEMHFWWRFKDQJHDQGFRUUHFWLRQZLWKRXWQRWLFHRULQFXUULQJREOLJDWLRQV'HWHUPLQLQJWKH
DSSOLFDWLRQDQGVXLWDELOLW\IRUXVHRIDQ\SURGXFWLVWKHUHVSRQVLELOLW\RIWKHLQVWDOOHU
$GGLWLRQDOO\WKHLQVWDOOHULVUHVSRQVLEOHIRUYHULI\LQJGLPHQVLRQDOGDWDRQWKHDFWXDOSURGXFW
SULRUWREHJLQQLQJDQ\LQVWDOODWLRQSUHSDUDWLRQV
,QFHQWLYHDQGUHEDWHSURJUDPVKDYHSUHFLVHUHTXLUHPHQWVDVWRSURGXFWSHUIRUPDQFH
DQGFHUWLILFDWLRQ$OOSURGXFWVPHHWDSSOLFDEOHUHJXODWLRQVLQHIIHFWRQGDWHRIPDQXIDFWXUH
KRZHYHUFHUWLILFDWLRQVDUHQRWQHFHVVDULO\JUDQWHGIRUWKHOLIHRIDSURGXFW
7KHUHIRUHLWLVWKHUHVSRQVLELOLW\RIWKHDSSOLFDQWWRGHWHUPLQHZKHWKHUDVSHFLILF
PRGHOTXDOLILHVIRUWKHVHLQFHQWLYHUHEDWHSURJUDPV
1900 Wellworth Ave. • Jackson, MI 49203 • 517.787.2100 • www.marsdelivers.com
04/2017
Loading...