Magic Chef 3888WVS, C6892XVS Owner's Manual

......,......,.-.....,.-,...,,......,,......,....,.,,-.....,......., ....., ,...-,........-..-.-,......,......,................,,................._...,.....,.............,.

• .. , ...., . ......., . .......................... , .........., . .. , ......., . ......., . ............... ,......, . ..

': ••-: • %-: •..': • %': ...:...:•..-:...,:....: •-.':..,:• ..': •.,-:. %.;...-: •..': • ..: •..-: •,': , ..': •..-: • %':...: •-.-:• %';...: • %,:• %': °..:• %': •..-:..,; •.,: •-.-: ,_

_i_i_".:_,:' :_:_•!."L:-::,ii:.-_L:•;_•_"L_-__'::_;L_":L:._-:;L_",iL_:::L:_-:_•_".|_:: _.::L:":L_Li:L_-.,:IL::.::e- :,_,•:-:._:::- '-::.;::..::--.._:::.:,":: "-:': " ,,_;-...:"-_!-9,:-:;_i,:._::,: :. ::,_,:._.." :.,.":::.:,-:-3

ili!'i llyf" iiiii2ii:ii:ilZiliiiiiill:ii:iiiiiii:ii:i:illilililiiiiiiiiiiiiiiiiill:iiiiiiii:iiiiiilliiiiilliii iiiiiiiil)i:i:iiiiiiiill:iiiiiiiiii:i)iii:iiiii:iiii:iiiiilliiiiii:iii!iiiii:i:!:illiiiiiiiill

::;2-.":"2-.":;2..":;2-.":;2-;':"2..":;2..":;2..":;2..":;2..":;2-,":;2.;':;2.."::2.."::2..":;2-.":;2.,":;2..":;2..":;2,,":"2..":;2..":;2..::'2..":;2..".";2..":;2..":;2..":;2-.":;2.,":;2..":;2..":;2-.":;2.."::2-

TABLEOFCONTENTS

IMPORTANTSAFETYINSTRUCTIONS ......... 1-4 Roastingandchart........................... 16

Automaticovencookingfeature............. 17-18

CLOCKAND OVEN CONTROL .................. 5 Broilingandchart ............................ 19

SURFACECOOKING ........................... 6 CONTINUOUSCLEANING OVEN

Controlknobs ................................ 6 (ChateauRange) ............................ 20

Cookingtips .................................. 6

Cookware.................................... 6 SELF-CLEAN OVEN ........................ 21-22

Heatsettingguide ............................. 6

SMOOTHTOPCOOKTOP ..................... 7-8

COIL ELEMENTCOOKTOP ..................... 9 Cooktoplight ................................ 25

OVENUSE ................................. 10-19 Backpanel light(Chateau Range).............. 25

Ovenlight .............................. ..... 10 Upperoven light (ChateauRange) ............. 25

Ovenvent ................................... 10 Cooktop .................................... 26

Ovencharacteristics..... i .................... 10 Oven door .................................. 26

Fan ........................................ 10 Storagedrawer .............................. 26

Ovenracks................................... 11 Levelinglegs ................................ 26

Howto set oven .... .......................... 12

Preheating ...... :........... :............... 12 SERVICEINFORMATION.................... 27-29

Useof aluminumfoil .......................... 12 Explanationoffaultcodes..................... 27

Upperoven(ChateauRange) ................. 13 Adjustingoventemperature ................... 27

Generalbakingtips .......................... 14 Beforeyoucallforservicechart ................ 28

Commonbakingproblemschart ............... 15 Howtoobtainservice......................... 29

CARE AND CLEANING CHART .............. 23-24

MAINTENANCE ............................ 25-26

Ovenlight ................................... 25

Themodelandserial numbersarefoundonthe ratingplatelocated

INSTALLE R Please leave this onthe rangefrontframe.Openthe storagedraweror ovendoorto manualwiththis appliance.

Besureappliancehas beenproperly installed. Serial Number:

seethe rating plate.

ModelNumber:

CONSUMERTosaveyoutime, Dateof Purchase:

energyand money,read and keep Pleasekeep yoursales receiptand/oryourcancelledcheckas

thismanualforfuturereference, proofofpurchaseshouldwarrantyservicebeneeded.Storethese

documentswiththisbooklet.

8113P141-60

(09-96-00)

/}'-I,

/ _ L .,

IMP()RTANTSAFETYINSTRUCTI()NS

Read all instructions before using this appliance.

Congratulationson your choiceof this range. As you use Instructionson the followingpages are based on safety your new range, we knowyou will appreciatethe many considerationsand mustbestrictlyfollowedto eliminatethe features that provide excellent performance, ease of potentialrisks offire, electricshock,or personalinjury. cleaning,convenienceand dependability.

Newfeatures have dramaticallychanged today's cooking WARNING

appliancesand the way we cook. It is therefore very Ap'- _k important to understand how your new electric range

operatesBEFOREyouuseitforthe firsttime. I " ALL RANGES CAN TIP AND InthisOwner'sGuide,youwillfind a wealthof information CAUSEINJURIESTO PERSONS.

regardingallaspectsofyourappliance. Byfollowing the

properlymaintainyour new range. NOTE:Yourappliance PACKEDWITH RANGE. maynotbeequippedwithsomeofthefeaturesreferredtoin

thismanual. I

• FOLLOWALL INSTALLATIONI

Shouldyou have any questionsabout using your new INSTRUCTIONS. electricappliance,pleasewritetous atthis address:

instructi°nscarefully, y°uwillbeablet°fullyenj°yand I _ • INSTALL ANTI-TIP DEVICES

CustomerAssistance c/oMaytagCustomerService WARNING: Toreducethe riskoftippingof theappliance

P.O.Box2370 fromabnormalusageor by excessiveloadingofthe oven Cleveland,TN 37320-2370 door,theappliancemustbesecuredbya properlyinstalled

Be sureto includethe modeland serialnumbersofyour appliance.For yourconvenience,wehaveprovidedspace Iftherangeismovedfromthe wallforcleaning,besurethe

onthefrontcovertorecordthisinformation, anti-tip deviceis engagedwhen the range is replaced. Inourcontinuingeffortto improvethequalityofour cooking rangeto verify that oneof the rearlevelinglegsis properly

products,it may be necessaryto make changesto the engagedinthebracketslot.Theanti-tipdevicesecuresthe

appliancewithoutrevisingthismanual, rearlevelingleg tothe floorwhen properlyengaged.

anti-tipdevice.

Removestoragedrawer,ifequipped,and lookunderneath

IMPORTANT SAFETY N;TRUCTIONS

Besure applianceis properly installedand groundedby a

qualifiedtechnician.

Turn off applianceand ventilating hoodto avoidspreading

Locateand mark circuit breaker or fuse. Never replacea

blown fuse or reset a circuit breaker until you know what smokeand odor. causedthe problem.Always replacea blown fusewithone Use drychemicalor foam-type extinguisheror bakingsoda ofthe correctamperage,do not usea substitute, to smotherfire or flame. Neveruse water on a greasefire.

To ensure proper operationand avoid possible injury or door. damageto unit do notattempt to adjust, repair,service, or Iffire is in a pan on the surface element,cover pan. Never

replace any part of your applianceunless it is specifically attemptto pickup or movea flaming pan. recommendedin this book. All other servicing should be

referredtoaqualifiedinstallerorservicer.Alwaysdisconnect powerto unitbefore anyservicingbytrippingcircuit breaker

tothe OFF positionor removingthe fuse.

Besureallpackingmaterialsare removedfromtheappliance cool in a safe place,out of reachof beforeoperatingit. small children. Children should be

Do notstore or use gasolineor other flammablematerials, Children should not be allowed to vaporsand liquidsin the oven, near surface units or in the play with controls or otherparts of vicinityof this or anyotherappliance.Thefumes cancreate the unit.

afire hazardor explosion. CAUTION: Do not store items of

If appliance is installedneara window,proper precautions anapplianceor onthe backguardof

should be taken to prevent curtains from blowing over a range. Children climbing on the

surfaceelements, appliance or on the appliance door

Do notleaveany itemsonthe cooktop.The hot air from the injured. ventmayigniteflammableitemsandmayincreasepressure

in closedcontainerswhich maycausethemto burst.

the flame. Extinguish flame then turn on hood to remove

If fire is inthe oven or broiler pan, smotherby closing oven

Do not leave children alone or unsupervised near the appliancewhenitisinuseorisstill hot.Childrenshouldnever beallowedto sit or standon anypartofthe appliance.

Childrenmust betaught that the applianceand utensilsin

or on it can be hot. Let hot utensils

taughtthat an applianceisnotatoy.

interesttochildrenincabinetsabove

to reach items could be seriously

Many aerosol-type spray cans are EXPLOSIVE when To preventinjury or dama(e to the appliance,do not use

exposedto heat and may be highlyflammable. Avoidtheir appliance as a space \

useor storagenearan appliance, heaterto heator warm a

room. Also, do not use

Many plastics are vulnerable to heat. Keep plastics away the cooktopor oven as a frompartsoftheappliancethat maybecomewarmorhot.Do storage area for foodor

notleaveplastic itemson the cooktopasthey may melt or cookingutensils. soften if lefttoo close to the vent or surface element.

To eliminate the hazard of reaching over hot surface or at the right rear ele- /

elements,cabinet storage should not be provideddirectly ment. Keepovenventduct unobstructed.Blockageof the abovea unit. Ifsuchstorageis provided,itshould belimited vent prevents proper oven air circulation and will affect

to items which are used infrequentlyand which are safely oven performance.Avoidtouchingvent areawhileoven is

. stored in an area subjected to heat from an appliance, on and for severalminutes after oven isturned off. Some

Temperatures may be unsafe for some items, such as partsof the ventandsurroundingareas may becomehot

volatileliquids,cleanersor aerosolsprays, enoughto causeburns.

The oven vent is located atthe rearofthe cooktop

IMPORTANT SAFETY NSTRUCTIONS

Donottouchsurfaceor ovenelements,areasnearelements cooking on a higher heat settingthen reduce to a lower

or interior surface of oven. Heating elements may be hot setting to continue cooking. For smoothtops: To prevent even though they are dark in color. Areas near surface believers,reduceto thedesiredheatsettingjustas thefood elementsand interiorsurfacesof an oven may becomehot beginsto cookor waterbeginsto boil. enoughto causeburns.Duringand after use, donottouch, or let clothingor otherflammablematerialscontactheating Never leave a surface cooking operation unattended elements,areas near elements,or interiorsurfacesof oven especially when using a r,_ _ .t1 untiltheyhavehad sufficienttime tocool. highheatsettingor when

Othersurfacesofthe appliancemaybecomehot enoughto cause smoking and cause burns - among these surfaces are the cooktop, greasy spillovers may surfacesfacingthecooktop,ovenventopeningandsurfaces ignite. Clean up greasy neartheventopening,ovendoor,andoven window, spills as soon as

Do notallowaluminumfoil, meat probesor any other metal heat for extended object,otherthan a utensilona surfaceelement,to contact cookingoperations.

heatingelements. Do nottouch a hotoven lightbulb with a damp clothas the Alwayslet quantitiesof hot fat used for deepfat fryingcool

bulb could break.If bulb breaks, disconnect powerto the beforeattemptingto moveor handle.

applianceto avoidelectricalshockthenremovebulb. Never heat an unopened container as pressure build-up

CAUTION:Donotusean _ _ / injuryordamageto theappliance.

applianceasa stepstool

to cabinets above. . Usedry,sturdypotholders.Moistordamppotholderson hot Misuse of appliance surfacesmaycauseburnsfromsteam. Donotletpotholders doors or drawers, such touchhotheatingelements.Donotuseatowelor otherbulky

as stepping, leaning or _ cloth. sitting on the door or

deepfat frying. Believers

possible.Donotuse high

may cause containerto burst resulting in serious personal

possible tipping of the accumulatein or near theappliance,vent hoodor vent fan. appliance, breakage of Cleanhoodfrequentlyto preventgreasefrom accumulating

drawer, may result in / , Do not let cooking grease or other flammable materials

door,and seriousinjuries, onhoodorfilter.Whenflamingfoods underthehoodturnthe

Alwaysturnoffsurfaceelementor theovenwhen cookingis fires. Loose fitting or long completed, hanging-sleeved apparel

It is normalfor some partsof the cooktop,especiallyareas cooking. Clothingmayignite surroundingthe surface elements,to become warm or hot or catch utensilhandles.

duringsurface cookingoperations.Therefore,do not touch

the cooktop until it has had sufficienttime to cool. If Alwaysplaceoven racksin the desiredpositionswhileoven

necessary,usedry pet holdersto protecthands, is cool, Slide oven rack out to add or remove food; avoid Do notcookon a brokenceramicglass cooktop.If cooktop is hot, usea dry potholder andavoid touching hot element

should break, cleaning solutions and spillovers may inoven.

penetratethe brokencooktopand create a risk of electric

shock.Contacta qualifiedtechnicianimmediately. Usecarewhen openingthe ovendoor. Let hot air orsteam

Makesuredrip bowlsare inplace.Absence ofthese bowls

during cooking may subject wiring or components

underneathto damage. PREPAREDFOODWARNING:Followfoodmanufacturer's AIwaysplaceapanonasurfaceelementbeforeturningiton. distorts, warps, or is otherwise damaged during cooking,

Be sure you know which knob controls which surface immediately discard the_foodand its container.The food element.Make surethe correctelementisturnedon. Begin could becontaminated.

fan offasthe fan may spreadthe flame.

Use cautionwhen wearing garments made of flammable material to avoid clothing >,_ __,_]

should not be worn while

reachinginto the oven. If a rackmustbemovedwhile oven

escapebeforeremovingor rePlacingfood.

instructions.Ifaplasticfrozenfoodcontainerand/orits cover

MPq)RTANT SAFETY NSTRUCTIONS

careto avoidsteam burnsif awetspongeor clothisusedto wipe spills on a hot surface. Some cleaners can produce

Useproperpansize.Thisapplianceisequippedwithone or noxiousfumes ifappliedto ahot surface.

more surface elementsof different sizes. Select utensils having flat bottoms large enough to cover the surface Do not soak or immerse removable heating elements in

element.Theuseofundersizedutensilswillexposeaportion water: Immersingelement in water would damageelement of the heatingelement to directcontact and may result in andinsulatingmaterialinsideelement. ignitionof clothing.Properrelationshipof utensilto element

will also improveefficiency. Donot usealuminumfoil orfoil linersto linedripbowls,cover

anoven rackor linethe oven bottom.Improperuseofthese Use pans with flat bottoms and handles that are easily liners may result in a riskof electricshock, or fire and may graspedandstaycool.Avoidusingunstable,warped,easily causeoventooverheat.Usefoilonlyasrecommendedinthis

tippedor loose handledpans.Pansthat are heavyto move booklet. whenfilled withfood mayalso be hazardous.

Besureutensilis largeenoughto properlycontainfood and

avoidboilovers.Pansizeisparticularlyimportantindeepfat frying.Besurepanwillaccommodatethevolumeoffoodthat

isto beaddedas wellas the bubbleaction offat. Clean only parts listed in this booklet. Do not clean door

To minimize burns, ignition of flammable materials and shouldbetaken notto rub,damage,ormovethe gasket.Do

spillageduetounintentionalcontactwiththeutensil,donot notuseovencleanersor ovenlinerprotectivecoatingsofany extend handles over 1)) kind inor aroundany partof theself-clean oven.

EE_ _ OVEN

gasket.The doorgasket is essentialfor agood seal. Care

panhandlestowardthe ' racks, andotherutensils,andwipeoffexcessivespillovers side or back of the topreventexcessivesmokeor flareups.CAUTION: Do not appliance,not out into leave food or cooking utensils,etc. inthe oven during the

elements. Always turn _ Before self-cleaning the oven, remove broiler pan, oven

the room where they self-cleancycle. are easily hit or

adjacent surface __

reached by small Onsomemodels,afanshouldbeheardduringtheself-clean

children, cycle. If not, cancelthe clean cycle and call a qualified

technicianbeforeself-cleaning again.Referto theTableof

Neverleta panboildryasthiscoulddamagethe utensiland Contents for location of self-clean instructionsand for fan

theappliance, information,ifequipped. Follow the manufacturer's directions when using oven

cookingbags. Itisnormalforthe cooktopofthe rangetobecomehotduring

a self-clean cycle. Therefore, avoid touching or lifting the

Only certain types of glass, glass/ceramic, ceramic, cooktopduringaclean cycle. earthenwareor glazed utensils are suitablefor cooktop or

oven usagewithout breakingdue to the suddenchange in temperature.

Thisappliancehas beentested for safe performanceusing conventional cookware. Do not use any devices or The CaliforniaSafe DrinkingWater and ToxicEnforcement

accessoriesthat are not specifically recommendedin this Act of 1986 (Proposition 65) requires the Governor of manual.Donot useeyelidcoversfor thesurfaceunits,stove Californiato publisha listof substancesknowntothe State

top grills, or add-on ovenconvection systems.The use of of California to cause cancer or reproductive harm, and devicesoraccessoriesthatarenot expresslyrecommended requires businesses to warn customers of potential

in this manualcan createserious safety hazards, resultin exposuresto such substances.Users ofthis applianceare performance problems, and reduce the life of the hereby warned that when the oven is engaged in the

componentsof the appliance, self-clean cycle, there may be some lowlevel exposureto

someof the listed substances,includingcarbonmonoxide. Exposuretothesesubstancescanbeminimizedbyproperly

Turnoff allcontrolsandwaitforappliancepartstocool before byopeningthe windowsand/ordoor in the room where the

touchingorcleaningthem.Cleanappliancewithcaution.Use applianceis located..

ventingthe Oventothe outdoorsduring the self-clean cycle

SAVETHESE INSTRUCTIONS

CLOCK AND OVEN CONTR()L

All indicatorwordsare displayedtoshowtheir location.The touchpadsonyourrangemay notlooklikethLsillustrationbutthey wiltoperate as describedin this manual.

cLEANBROILLOCK STOPTIMEor OVENSTOP.

I.I I !/ sDTEo_¥TI_EERD_ This pad will operate as

BAKECLEAN described below.

I I ____I" rl I This function pad on your

Press this pad to cancel all programming except the clock 1. Press OVEN TEMP pad.

and timer. 2. Press the • or • pad to set oven temperature.

See pages 12 to 15 for additional information.

Press or press and hold these pads toenter the desired time or temperature or to select Hi or Lo broil.

1. Press BROIL pad.

2. Press • or • pad to select Hi broil or Lo broil. See page 19for additional information.

1. Press TIMER pad.

2. Set desired time using the • and • pads. Press or press and hold either pad to change the time by 1 1. Close and lock oven door.

minute, 5 minutes or 10 minutes.

TIMER can be set from 1minute (0 HR:01) upto 9 hours and 3. Oven will automatically clean for 3 hours. Or press the • 50 minutes (9 HR:50). or • pad to select 2to 4 hours.

The timing operation will start automatically. Colon flashing "door" Will appear in display until the door isproperly locked.

in the display indicates a timing operation. One long See pages 21 and 22 for additional information.

continuous beep signals the end of the timing operation. The time of day will automatically reappear in the display. The

TIMER does not control the oven. To cancel" Press and hold TIMER pad. Time of day will 1. Press COOK TIME pad. Enter desired cooking time with

reappear after a slight delay, the • or • pad.

1. Press CLOCK pad. • or • pad.

2. Set the correct time of day using the • and • pads. Tochange the time byone minute, presseither padonce. To The oven will automatically turn on and off at the preset

change the time in increments of 10 minutes, press and times. Beeps will signal the end of cooking. Press CANCEL hold either pad. for additional information.

When power is first supplied to the oven or ifthere has been

a power failure, the display will flash.

Press CLOCK pad to recall time of day when another

function is displayed. A beep sounds each time a pad is pressed. The oven will

Clock time cannot be changed when oven is set for a cook, automatically turn off if it is left on for 12 hours.If a fault code timed bake, or self-clean operation. Cancel operation to set (example: F 2) is displayed and beeps sound, press the clock. CANCEL pad. If fault code continues, see page 27.

2. Press CLEAN pad.

2. To delay the start ofcooking: Press STOP TIME or OVEN STOP pad. Enter time you wish the oven to turn off with

the • or • pad.

3. Press OVEN TEMP pad. Enter oven ternperature with the

pad to cancel end-of-cooking beeps. See pages 17 and 18

SURFA(;E COOKING

Yourcooktopisequippedwithcontrolknobsthatprovidean Use HIGH just untilwater comes to a boil or pressureis infinitechoiceofsettingsfrom LOWto HIGH.The knobcan reachedinthe pressurecanner.Then,reduceto the lowest beset onor betweenany of the numberedsettings, heatsettingthat maintainsthe boil or pressure.Prolonged

Tooperatepushinandturntheknobineitherdirectiontothe produce excessive heat. Excessive heat can cause desiredsetting. An indicator light will glow when a surface permanentdamageto the porcelaincooktop,coil element

elementisturnedon. The indicatorlightwill remainon until and the drip bowl.See page 9 for additionalinformation.

theelementisturnedoff.Aftera cookingoperation,besure the elementand indicatorlightareoff.

Topreventdamageto therangeorutensil,neveroperate bestresultsusea heavygaugemetalpanwithasmoothflat

surfaceunitwithoutapaninplace,neverallowapantoboil bottomanda tightfittinglid.

dryandneveroperatean elementonHIGHfor extended periodsoftime. Cookwarewithuneven,warped,orgroovedbottomsdonot

Foodwillnotcookanyfasterata highersettingthanneeded conductivityandresultinslower,lessevenheating. to maintain a gentle boil. Water boils at the same Differenttypesofcookwarematerialsrequiredifferentheat

temperaturewhetherboilinggentlyor vigorously.If a high settingsforthesamecookingoperation.Thechartbelowis

settingisused,excessivespatteringwilloccurandfoodmay basedonheavygaugealuminumcookware.Lowertheheat stickor burnontothebottomofthepan. settingifusingathinnergaugemetalorothermaterials.

use of HIGH or the use of incorrect canning utensilswill

Cooking performance is greatly affected by the type of cookwareused.Propercookwarewillreducecookingtimes,

uselessenergyandproducemoreevencookingresults.For

makegoodcontactwiththeheatingsurface,willreduceheat

Ifa higherheatsettingisusedto bringliquidto a boilorto Oversizedcookwareand cookwarethat restsacrosstwo begincooking,alwaysreducetoa lowersettingonceliquid elementsarenot recommendedas theymay trapenough

comesto a boilorfoodbeginscooking.Never leavefood heatto causedamagetothe cooktoporelements.This is unattendedduring a cookingoperation, especiallyimportantwhencanning.

Fitthesizeofthe cookwaretothesizeofthe element.This Donotusewoksequippedwithroundmetalrings.Thering, conservesenergy, whichisdesignedtosupportthewokabovetheelement,will

trapheatandmay damagetheelementandthe cook'top.

Referto cookwaremanufacturer'srecommendationsfor suggestedheatsettings.Somemanufacturersdonotrecommend

the useof HIGH.orthe useof HIGHfor extended cookingoperations.

HIGH Tobringliquidto a boil,blanch, preheatskillet,or reachpressure ina pressurecooker.

Always reduceto a lowerheatsettingwhen liquidsjust beginto boilor foods beginto cook.

Medium-High Tobrown or sear meat; heatoil for deepfat frying;scald;to sauteor fry.

7-9 Maintainfast boilforlarge amountsof liquids.

Medium To maintainmoderatetoslow boilfor largeamountsof liquids.

4-6 Tocontinuecookinguncoveredfoodsandfor mostfrying operations.

Medium-Low Tocontinuecookingcoveredfoodsand to maintainpressurein most pressurecookers.

1-3 Stew,braiseor steamoperations.

To maintainboilfor smallamountsof liquid,poach, steamor simmer.

LOW Tokeepfoods warm beforeserving.Melt chocolate.

SMOOTHTOP COOKTOP

IOn Canadian models only: The surface units will not I When cooking delicate foods which easily scorch oroperateduringa clean cycle.This is normal. I overcook, start with a lower heat setting then gradually

The four cooking areas on _\\\lllll/_ _J//_ then reducetothe lowersetting. Ifyoudo begincookingon your rangeare identifiedby _._///___ _ HIGH,reduceto a lowersettingbeforeliquidscome to afull

permanent patterns in the _/1_ .boil.

cooktop.Therearetwo large

(8-inch) and two small .\\\\11//_. _l_ Iffoodiscookingtoofastorifaboiloveroccurs, removelidor (6-inch)areas.The patterns _ removecookwarefrom cookingareaand reduceto a lower

onyourcooktopmaynotlook -///t_\_- _ll_ setting.Allowenoughtime for the cookingarea to adjustto like the cooktop in this the newsetting.

illustrationbut your cooktop will operate as described in thismanual.

Beforeusingthe cooktopforthefirsttime, cleanitthoroughly Aluminum foil willdamagethesmoothtopifitmeltsontothe as directed on the cleaning chart on page 24. This will glass. Do not use aluminum foil or foil-type disposable protectthe smoothtopand will guarantee a clean cooktop containers such as popcorn poppers under any

whenthe elementsareturned on. circumstances. They may leave metal marks or may Duringthe first few hoursof use,you may noticethat the metal or aluminumfoil melts onto the smoothtop. Call an

cooktopemitsaslightburning odoranda lightsmoke.Both authorized servicer. Do not attempt to repair cooktop oftheseconditionsare normal, yourself.

Whenacookingareaisturnedon,the coilelementunderthe Aluminum cookware willcausemetalmarks ontheglassif

cooktopwill heat up and glow red. To maintain the heat you slide them acrossthe smoothop. Remove any metal settingtheelementwill cycleon andoff.It isnormaltosee a marksimmediatelyusingCooktopCleaning Creme.

red glowthrough the smoothtopwhen the elementcycles

on. heat-proof glass or glazed cookware may scratchthe

increase the setting until you find the optimum setting. Boiloversare morelikelyto occur ifyou start out on HIGH

permanentlymeltontothe smoothtop.Donot usecooktopif

Glass ceramic, earthenware, porcelain over metal,

smoothtopcooktop ifyou slidethem acrossthe top.

Yourrangeisequippedwith a HOTSURFACElightlocated at the center-back ofthe smoothtop.This redlightwill turn

on to indicatethat the smoothtopis hot and will remainon • Donotusethetop asaworksurfaceorasa cuttingboard. untilthe top hascooled. Do notcookfood directlyon the cooktop.

• Do not use a trivet or metalstand (suchas a wok ring) between the utensiland the cooktop. These items can mark or etch the surfaceand affectcookingefficiency.

Thesmoothtopcookingarearetainsheatforaperiodoftime • Donotplaceplasticsonawarmorhotcookingarea.They afterthe elementhasbeenturnedoff.Turnthe elementoffa will melt and adhere to the smoothtop. The smoothtop

fewminutesbeforefood is completelycookedand use the maychipor pitinattemptingtoremovemeltedplasticfrom retained heat to completethe cooking operation.After 30 the top.

minutes,the cooktop maybe too coolto keepfoodswarm. • Topreventscratchingordamagetothe smoothtop,donot However,the TOPMAYSTILLBETOOWARMTOTOUCH. leavesugar,salt,sand,soil,shorteningorotherfatsonthe Whenthe HOTSURFACElightturns off,the topwill becool cooking area. Be sure area is free from these before enoughto touch, turning oncookingarea.

• Besurethe bottomofthecookwareissmoothandfree of nicks,scratches or roughareasas they mayscratchthe

smoothtop.

• Donotallowapantoboildry.Thiscouldcausepermanent damageto the smoothtop.

SMOOTHTOP COOKTOP

To help keep cooktop clean, be sure cooking area and When surface is cool, clean as directed in the chart on page cookware bottom are clean and dry before each use. 24. DO NOT USE the following cleaning agents:

Topreventpossibledamagetothecooktop, alwaysrinsethe • Abrasives (metal scouring pads, cleansing powders, bottom of cookware to completely remove any cleaning scouring cleaners or pads) will scratch the smoothtop.

agent residue. This is especially important when using a • Chemicals (oven cleaners, chlorine bleaches, rust copper or aluminum cleaner. In the presence of heat, the removers or ammonia) may damage the finish of the cleaning residue may stain, discolor or etch the smoothtop, smoothtop.

• Glass cleaners containing ammonia may harm the

Carefully blot up spillovers around the outside of the cooking smoothtop. area as they occur with dry paper towels. BE CAREFUL

NOT TO BURN HANDS WHEN WIPING UP SPILLS. DO • Soiled cloth or sponge will leave an invisible film on the NOT USE A DAMP CLOTH WHICH MAY CAUSE STEAM cooktop which may scratch or cause discoloration the BURNS. next time the cooktop is used.

CAUTION: Do not use cooktop if the smoothtop -is I IMPORTANT: Watch sugary solutions carefully to avoid

an authorized servicer. Do not attempt to repair the boils over, it may pit the smoothtop. Turn element toLOW cooktop yourself, and clean sugary boilovers immediately. See page 24 for

cracked, broken, or if metal melts onto the cooktop. Call l believers. If a sugar solution (such as jam, jelly, candy)

complete cleaning instructions.

PROBLEM CAUSE

Tiny scratchesor Coarseparticles (dust,salt and Tinyscratches arenotremovableanddo notaffectcooking.In abrasions sand)betweenceokware bottom time, the scratcheswill becomesmootherand lessvisible. Be

Metal-marking Slidingor scrapingmetalutensilsor Do not slide metal object across cooktop.When cool,clean

Brownstreaksand Boilovers,incorrectcleaning Remove boilovers before reusing the cooktop. Use a clean specks materials,usedsoiled cloth or cloth orsponge. Be sure cookware,especially bottoms,are

Areasofdiscoloration Mineraldeposits fromwaterand Usecookwarewithbottomsthat arecleananddry.Usecorrect with a metallicsheen foods, heatsettingto preventboilovers.

Pittingor flaking. Sugaryboiloversfrom sugarsyrups, Use correct heat setting and large enough utensil. Watch

and cooktop.Incorrectcleaning surecookwarebottomsandcooktoparecleanbeforeuse.Use materials.Sliding glasswareor metal cookwarewith a smooth,non-scratching bottom.Donot slide

acrosstopor usingcookwarewith cookwareacrosscooktop. roughbottoms.

ovenracksacrosscooktop, with CooktopCleaningCreme.

sponge,soiledcookware, cleanand dry.

candy,jams, jellies, dessert sauces, cookingoperationto prevent boiloversor spattering. etc.

C()IL ELEMENT COOKTOP

• Coil surfacb elements are self-cleaning. • Be sure drip bowls, located under each element, are in

• Do not immerse elements in water, place.

• Absence of these bowls during cooking may subject

• When an element is turned on, it will cycle on and off to wiring or component parts underneath the cooktop to maintain the heat setting, damage.

• Toprevent damage to the range, NEVER operate surface • To prevent risk of electric shock or fire, do not line drip element without a pan in place and NEVER allow a pan bowls with aluminum foil.

to boil dry.

Your range will be equipped with either chrome plated or

To remove: When _._ . porcelain coated steel drip b6wls. cool, raise element

and carefully pull out Chrome drip bowls will turn blue or gold over time or if and away from the overheated. This type of discoloration is permanent and will

receptacle, not affect cooking performance.

To protect the chrome or porcelain finish, avoid using high settings for long periods of time. Reduce to a lowersetting

To replace: Insert the terminals on the element into the oncefood begins cooking. Do not use oversized cookware. receptacle. Gently liff up onouter edge of element (opposite Pan should notextend more than 2 inches from the element.

terminal-side of element) while inserting terminals into receptacle. Gently press down on outer edge of element Iftheovenventislocatedattherightrearelement, besure

until element sits level on drip bowl. the drip bowl for this element has a hole in the center to

Be sure drip bowls are properly installed. Notch on trim ring allow proper oven venting. To prevent baking problems, should be centered over the screw securing the receptacle to the maintop. If trim ring is not installed properly and rests in this location or by covering the hole in the center of the on this screw, the trim ring and drip bowl will "rock". drip bowl with aluminum foil.

never block the vent opening by placing a solid drip bowl

CANNINGELEMENTACCESSORYKIT

(MODEL CE1)

The use of oversized cookware or large canners on the coil element cooktopmay result indamage tothe porcelain enamel finish.A special canning element has been designed to protect the finish when using

this type of cookware. The canning element and chrome drip bowl are available as an optional accessory kit.

For information on the Canning Element Accessory Kit, contact your

dealer orwrite to Maytag Customer Service, P.O.Box 2370, Cleveland, TN 37320-2370.

NOTE: For additional canning information contact your local County Extension Office. Or, contact AIItrista Consumer Products Company, marketer of Ball brand home canning products at 800-240-3340 or write: AIItrista Corp., Consumer Affairs Dept., P.O. Box 2729, Muncie,

IN 47307-0729.

OVEN USE 10

Theovenlightswitchis locatedonthe controlpanel.Toturn Because each oven has its own personal baking theoven lighton, pushinthe bottomhalf ofthe switch, characteristics, do not expect that your new oven will

performexactlylikeyour previous oven. You mayfind that thecookingtimes, oventemperatures,and cookingresults differsomewhatfromyour previousrange.Allow aperiodof adjustment. If you have questions con.cerning baking

Theovenvent islocatedat therearofthecooktop orat the information. rightrearsurfaceelement.Whentheovenisinuse,thisarea

may feel warm or hot to the touch. To prevent baking problems,do notblock theventopeningin anyway.

results,pleasereferto pages12,14,15and28for additional

Slide-in, drop-in and Chateaurangesare equippedwith a fanwhichautornaticallyturnsonwhenevertheovenissetfor

a cookingor a cleaningoperation.Aftertheoperation,the fanwillautomaticallyturnoffwhentheovenhascooled.

11 OVEN USE

The two oven racksare designed with a safety lock-stop For optimum baking resultsof cakes, cookies or biscuits, position to keep the racks from accidently coming useonerack.Positionthe racksothefoodisinthe centerof

completelyoutofthe ovenwhenpullingtherackouttoaddor the oven. Use either rackposition2 or 3. removefood.

, Ifcookingonmorethanonerack,staggerthefoodtoensure

CAUTION:Do not attemptto changetherack positions whentheovenis hot.

Toremove:Besuretherackiscool.Pulltherackstraightout

untilitstopsatthe lock-stop position.Tiltthe frontendof the rackup and continuepullingthe rackout of the oven.

Toreplace: Placethe rack onthe racksupportsand tilt the frontendofthe rackupslightly.Slideitbackuntilitclearsthe lock-stopposition.Lowerthefrontandslidetherackstraight in. Pullthe rack outto thelock-stop positionto besure it is

positionedcorrectlyandthen returnit to its normalposition. Ifcookingontwo racks,userackpositions2 and4 forcakes Itisimportantthataircancirculatefreelywithintheovenand placetwo cookie sheetson one rack.

around the food. To help ensure this, place food on the centerof theovenrack.Allowtwo inchesbetweenthe edge If roastinga largeturkey,placethe turkey onrack 1andthe

of the utensil(s)andthe ovenwalls, sidedisheson rack 5.

properairflow.

andrackpositionsI and4whenusingcookiesheets. Never

RACK5 Usedfor toasting bread,orfor two-rack baking.

(highestposition)

RACK 4 Usedfor most broilingand two-rack baking. 5

RACK3 Usedfor mostbakedgoodsona cookiesheetor 4_ _!

RACK2 Used for roasting small cuts of meat, large I

RACK 1 Used for roasting large cuts of meat and large

jelly roll pan,or frozen conveniencefoods, or for

two-rack baking.

casseroles, baking loaves of bread, cakes (in

either tube, bundt, or layer pans) or two-rack _ .-

baking. _-'__...,.

poultry, pies,souffles, or angel food cake, or for two-rack baking.

OVEN USE 12

1.Whenovenincool, positionthe ovenracks inthe oven. • Do not movethe doorlock leverto the rightduringa cooking operation.If the door is locked, the cooking

2. Pressthe OVENTEMP pad. operationwillbe cancelled.Ifthe ovenishot enoughto

• 000° and BAKE indicator words will appear in the engagethe internallock, theovendoor willnot open. display, unlockand open the door.

3. Press the • or • pad. Then press either paduntil the desiredoventemperatureis displayed. ° If you pressthe OVENTEMP pad and do not set an

• 350° will appear in the display when either pad Js automaticallycancelandthe timeofdaywillreappear

pressedonce. inthe display.

Ifthisoccurs,allowtheoventocool uptoonehour,then

oventemperaturewithin 30 seconds,the programwill

° The oventemperaturecanbe setfrom 170°to 550°.

• The ON indicator word and 75° or the actual oven the OVENTEMP pad.

temperature, whicheveris higher, will appear in the display. • Tochangetheoventemperatureduringcooking,press

• The temperature in the display will increase in 5° displayed.

increments until the oven reaches the preset temperature. • Theovenfeaturesanautomaticshut-off: Ifthe ovenis

• Allow10to 15minutesfortheoventopreheat.Asingle lefton for 12 hoursit will automaticallyturn off.

beepwill soundwhen the oven is preheated.

4. Place the food in the center of the oven allowing a minimumof 1 to 2-inches betweenthe utensil and the

ovenwalls. Donotcoverthe oven bottomor an entire rackwith foil

5. Checkfoodfor alonenessat the minimumcookingtime. placea pieceof foila littlelargerthanthe pan,on therack Cooklongerifneeded.Cookingtimemayvaryfromoven

tooven. to placethe foil directlyunderthe utensil.Cut a small

6. At theendof cooking,turntheovenoffbypressingthe openinginthefoiltoallowheattothebottomofthepan.This

CANCELpad.Removefoodfromtheoven. isespeciallyimportantwhenbakingpies.

Preheatingisnecessaryforbaking.Topreheat,settheoven tothedesiredtemperatureandallowabout10to 15minutes fortheovento preheat.A singlebeepwillindicatethatthe ovenispreheated.Itisnotnecessarytopreheatforroasting.

• Torecallthe presettemperatureduringpreheat,press

the • or • pad until the desired temperature is

or place foildirectlyundercookware.Tocatchspillovers,

belowthepan.Forrangeswithonerack,itwillbenecessary

Selectinga temperaturehigherthan desiredwillNOT I preheattheevenanyfaster,and mayhavea negative

effecton bakingresults.

(

The upperoven of the Chateaurange will featureeither a TO set upper oven: microwaveovenor a conventionalbakingoven. 1.When cool, place the oven rack in the desired rack

Microwaveoven: Refertothe separateUseandCareBook position.

for microwaveovenoperatinginstructions.

Conventionaloven:This ovenis equippedwithan electric bake elementandfeaturesthe ContinuousCleaningOven. OFF

See page20 for additional informationon the Continuous /'_--r_ _._55° CleaningOvenfeature. __/,/t____oo,, ,,

Thesize ofthe upperovenmakesit convenientfor cooking smaller quantities of food. However, itdoes have some 2oo._\_//f_" '5°

largebakeware.Largebakewarewill blockthe airflowand

limitations.Do not usea largecookingsheet, pan or other 2,o_.____4o0,_.-_,Z,_ " "7"_ _/_ affectcookingresults. 3oo _5.._o

Foroptimumresults,usethe lowerovenfor criticalcooking and delicatebaking. 3. Allowthe ovento preheatfor 10to 15 minutes.

Do notuse the upperovenfor cookingitemsthatare heavy minimum of two inches between the utensil(s)and the orbulkyto handle,especiallyifconsiderableamountsof hot oven wallsand ovendoor.

fat or liquidsare involved.Removingsuch foods fromthe oven isdifficultand canbe hazardous. 5. Checkthefood for donenessatthe minimumtime given

2. Push in and turn the thermostat knob to the desired

setting.

WARM

4. Place the food in the center of the oven, allowing a

inthe recipe.Cooklongerifnecessary.Openingtheoven door frequently causes heat loss which may affect

cookingresultsand increasecookingtime.

6. Turn the thermostat knob to OFF and removethe food fromthe oven.

Use a reliable recipe and accurately measure fresh • A dark, dull, anodized or satin-finish metal pan ingredients. Carefully follow directions for oven absorbs heat and producesdarker browningwith a

temperatureandcookingtime. crispercrust.Usedarkpansforpies,piecrustsorbread. Preheatoven if recommendedin the recipeor package • Foroptimumbakingresults,bakecookiesandbiscuitson

directions.Selectingatemperaturehigherthanthe desired aflat cookiesheet.Ifthe panhassides,suchasajellyroll

temperaturewill notpreheatthe ovenanyfaster.Infact,this pan, browningmay not be even.

mayhavea negativeeffectonbakingresults. • If using heat-proof glassware, or dark pans such as

Baker's Secretor Wiltonreducethe oventemperature

Use the correct rack position. Bakingresultsmay be by25°F exceptwhenbakingpiesorbread.Usethe same

affectedif the wrongrack positionis used. For optimum bakingtimeas calledforinthe recipe.

results,bakefoodsononerack.Selectarackpositionthat locatesthefoodin the centeroftheoven.If bakingon two racks,select rackpositions#2 and4, #1 and4 or #2and 5. Allow hot airto flowfreelythroughthe ovenforoptimum

• Top browningmay be darkerJffoodislocatedtoward optimumbrowningandevencookingresults:

thetopofthe oven.

• Bottombrowningmaybedarkeriffoodislocatedtoward cookiesheet,one 13x9x2-inchcakepan ortwo9-inch

thebottomoftheoven. roundcake pansononerack.

• When usingtworacksfor baking,allowenoughspace • Staggerpanswhenbakingontworackssoonepanisnot betweentheracksforproperaircirculation.Browningand directlyoveranotherpan.

cookingresultswillbeaffectedifairflowis blocked. • Allow onetotwo inchesbetweenthe panand the oven

bakingresults.Improperplacementofpansintheovenwill block air flow and may resultin uneven browning.For

• Donotcrowdarackwithpans.Neverplacemorethanone

walls.

Cookware material plays an importantpart in baking Check the cooking progress at the minimum time results.Alwaysusethetypeand sizeofpancalledforinthe recommendedintherecipe.Ifnecessary,continuechecking

recipe.Cookingtimesor cookingresultsmaybe affectedif at intervalsuntilthefoodisdone.Iftheovendooris opened

thewrongsizeis used. toofrequently,heatwillescapefromtheoven;thiscanaffect

• A shinymetalpanreflectsheatawayfromthefood.This

typeof panproduceslighterbrowninganda softercrust. If you add additional ingredients or alter the recipe,

Useshiny pans forbakingcakesor cookies, expectcookingtimesto increaseordecreaseslightly.

bakingresultsandwastesenergy.

15 OVEN USE

PROBLEM CAUSE

Cakesareuneven. ° Panstoo closeortouchingeachother oroven walls.° Batteruneven in pans.

• Temperaturesettoo lowor bakingtimetoo short.• Ovennot level.• Undermixing.• Too muchliquid.

Cakehigh in middle, oTemperaturesettoohigh. • Bakingtimetoo long.• Overmixing.• Toomuchflour.• Pans

touchingeach otheror oven walls. • Incorrect rackposition.

Cakefalls. • Toomuchshorteningor sugar.• Toomuchor too little liquid.=Temperatureset too low.

• Oldor too little bakingpowder.• Pantoo small. • Ovendooropenedfrequently.• Added

incorrecttype of oilto cakemix.. Added additionalingredientsto cakemix or recipe.

Cakes,cookies,biscuits , Incor_ectraCkposition.=Ovendoornotclosedproperly,•Doorgasketnotsea ngproperly

don tbrown evenly, I orproperlyattachedtodoor.' Incorrectuseofaluminumfoil:• Oven notpreheated,• Pans

darkened;dentedor warped:

j Foroptimumresuitslbakeon oneiack. i bakingcakesontworaCks,placepanstowardtheI

; ; frontoftheovenontheupperrackandtowardthebackof!heovenonthe!ower !aCk,

Cakes,cookies,biscuits • Ovennotpreheated.• Panstouchingeachotherorovenwalls.• Incorrectrackposition. toobrownon bottom. • Incorrectuseofaluminumfoil.• Placed2 cookiesheetsononerack.• Usedglass,dark,

stainedwarpedordullfinishmetalpans.(Usea shinycookiesheet.) Followcookwaremanufacturer'sinstructionsfor oventemperature.Glasswareanddark

cookwaresuchas Ecko'sBaker'sSecretmayrequireloweringthe oventemperatureby

25°R

Cakesdon'tbrown on :o!_correctraCkpositioni,Tempe_aturesettooiow:• overmixing.• Toomuchiiquid.•Pan

top. ; ; sizetoo largeortoolittlebatterinpan:;•Oven dooropenedtoooften.

Excesslve _hrinkage • TooIi_1_e_e_i_g • Ova'fruiting'• P_t_olalge:.Temperature set too high .Bak ng

timetoo long. • Panstoo closeto each otheror ovenwalls.

• TOOmuch quid:• Undermx ng.• Temperatureset too low • Bakingtimetoo short:

Cakeshave tunnels. =Notenoughshortening.• Toomuch bakingpowder.• Overmixingorattoo higha speed.

• Temperaturesettoo high.

Piecrust edgestoo • Temperaturesettoo high.• Panstouchingeachotheror ovenwalls.• Edges ofcrusttoo brown, thin; shieldwith foil.

: i :

Pies havesoakedcrust. • Temperaturetoo lowat start ofbaking. • Fillingtoo juicy.• Usedshiny metalpans.

OVEN USE 16

Roasting isthe method for cooking large, tender cuts ofmeat thus allowing better heat circulation for even cooking. As the uncovered,_ without adding moisture. Most meats are fat on top of the roast melts, the meat is basted naturally,

roasted at 325°F. it is not necessary to preheat the oven. eliminating the need for additional basting.

Place the roasting pan on either of the two lowest rack

positions. The cooking time is determined by the weight of the meat

Roasting Tips a meat thermometer. Insert it so the tipis inthe center of the

Use tender cuts of meat weighing three pounds or more. Some good choices are: Beef rib, ribeye, top round, high Remove the roast from the oven when the thermometer quality tip and rump roast, pork loin roast, leg of lamb, veal registers the desired temperature.

shoulder roast and cured or smoked hams.

Season meat, ifdesired, either before or after roasting. Rub USDA's Meat & Poultry Hotline at 1-800--535-4555. For into the surface of the roast if added before cooking, cooking information write to the National Live Stock and ]

Place the meat fat-side-up on a rack in a shallow roasting Illinois 60611. pan. Placing the meat on a rack holds itout of the drippings,

and the desired doneness. For more accurate results, use

thickest part of the meat. It should not touch fat or bone.

NOTE: I=or more information about food safety, call I

Meat Board, 444 North Michigan Avenue, Chicago, /

Approximate Oven Approximate*

Weight Temperature Internal RoastingTime

Cut of Meat (pounds) in °F Temperature (rain.per lb.) Beef

RibRoast(cut-sideLdown) 4to 8 325°F 160°F(medium) 30-35 RibEyeRoast 4to 6 350°F 160°F(medium) 30-35

TopSirloinRoast 3 to 6 325°F 160°F(medium) 30-35

Pork, Fresh

ShoulderBlade Roast,(boneless) 4 to 6 325°F 160°F 35-45 ShoulderBlade Roast 4 to 6 325°F 160°F 30-40

Loin Bladeor Sirloin Roast 3 to 4 325°F 160°F 35-40 BonelessPorkLoin 6 to 8 325°F 160°F 25-35

Pork,Smoked

Ham,Half (fully cooked)** 5 to 7 325°F 140°F 25-35 Ham,Half (cook-before-eating) 5to 7 325°F 160°F 35-45

Poultry

Turkey,unstuffed*** 12 to16 325°F 180°-185°F 18-20

Turkey,Breast 3to 8 325°F 180°F 30-40

Chicken,Fryer 2 1/2 to3 1/2 350-375° 180°F 20-24

Chicken,Roaster 4 to6 350-375°F 180°F 20-25

Lamb

Leg(boneless) 2 to 3 325°F 160°F 35-40

WholeLeg 5 to 7 325°F 160°F 30-35

* Cookingtimesare approximateand may varydependingon theshapeofthe roast.A meat thermometeristhe most accurateway

todetermine doneness.

** Addwaterandfollowpackagedirections.

*** Stuffedturkeyrequiresadditionalroastingtime.Shield legsand breast withfoil toprevent overbrowningand dryingofskin.

16 to20 325°F 180°-185°F 16-18 20 to24 325°F 180°-185°F 14-16

170°F 40-45

17 OVEN USE

The Automatic Oven Cooking feature is used to turn the To set oven:

oven on and off at a preset time of day. This feature can be

used to: 1. Place food in the oven.

• Turn the oven on immediately (immediate start), 2. Press the COOK TIME pad,

• Delay the start of cooking (delay start). • The words SET COOK TIME willflash inthe display.

The feature can be used with either oven cooking or the self-cleaning oven feature. See page 22 for instructions on

delaying the start of a clean cycle. 4, Press the OVEN TEMP pad.

The clock must be functioning and set at the correct time of • The words BAKE and 000° willappear in the display.

day for the Automatic Oven Cooking feature to operate properly, 5. Press the • or • pad to enter the oven temperature,

IMPORTANT The oven will immediately turn on.The words TIMED BAKE

• Highly perishable foods such as dairy products, ON will appear in the display and the display will begin pork, poultry, seafood, or stuffing are not countingdownthe cookingtime.

recommended forDelay Start cooking. At the end of the preset cooking time, the oven will

• If cooking more than one food, select foods that automaticallyturn off and END will appear in the display. cook for the same length of time and at the Same Continuousbeeps willremind you to remove the food from

oven temperature, the oven.

To recall the preset cook time or stop time, press the time of day will reappear in the display when the CANCEL correspondingpad. pad ispressed. Remove the food from the oven.

3, Press the • or • pad to enter the cooking time.

Press the CANCEL pad to cancel the beeps. The current

To cancel the AutomaticOven Cooking operation,pressthe CANCEL pad. Example For Immediate Start

At the end of the Automatic Oven Cooking operation, the Food is to cook for one hour and thirty minutes (1:30) at oven will automatically turn off and continuous beeps will 375°F'

sound to remind you to remove food from the oven. Press 1. Pressthe COOK TIME pad. the CANCEL pad to cancel the beeps.

This feature will only delay cookingup to eleven hoursand fiftyfive minutes (11:55). isdisplayed.

If you delay morethan 30 secondsbetween pressinga pad 3. Pressthe OVEN TEMP pad. and the • or • pad, the display will either:

• Return to the previous setting. The oven willturn onimmediately and willautomaticallyturn

• Beep and flash to indicatethe next entry, offat the preset time. Press the CANCEL pad to cancel the

• Returnto the currenttimeofdayandcancel theoperation, beeps.

2. Pressthe • I_aduntil 1:30 (one hour and thirty minutes)

4. Press the • pad until375 ° is displayed.

OVEN U,c;E 18

Toset oven: ExampleFor DelayStart

1. Placefoodintheoven. Foodis to cookfor one hourand thirtyminutes(1:30)at

2. PresstheCOOKTIME pad.

• The wordsSET COOKTIME willflashinthe display. 1. PresstheCOOKTIME pad.

3. Pressthe• or• padtoenterthecookingtime. 2. Pressthe• paduntil1:30(onehourandthirtyminutes)

• The cookingtime will be displayedin hoursand isdisplayed. minutes. 3. PresstheSTOP TIME orOVENSTOP pad.

4. PresstheSTOPTIME or OVENSTOP pad.

• The wordsSET STOPTIME willflashinthedisplay. 4. Pressthe• paduntil6:00isdisplayed.

5. Pressthe• or•padto enterthetimeyouwishtheoven 5. PresstheOVENTEMP pad.

toturnoff.

6. PresstheOVENTEMP pad.

• The wordsBAKEand 000°will appear inthe display. The oven will automaticallyturn on and off at the preset

7. Pressthe • or • padto enterthe oven temperature.

8. Press the CLOCKpad and the currenttime of day will reappearinthe display.

• DELAYBAKEwill appearinthe displayto indicatethat

the ovenis setfor a delaystartcooking operation.

The controlwill automaticallydeterminewhen to turn on I the oven basedon the COOKTIMEand STOPTIME or OVENSTOPtime youset. Itis NOT necessaryto set a

start time.

376°F.Youwishthe foodtobe cookedby6:00.

6. Pressthe• paduntil375° isdisplayed.

times. Pressthe CANCELpad to cancelthe beeps.

At thepreset time,the ovenwill automaticallyturn on and TIMEDBAKEONwill appearin the display.The displaywill

begincountingdownthe cookingtime. At the end of the preset cooking time, the oven will

automaticallyturn off and END will appear in thedisplay. Continuousbeepswill remindyouto removethe foodfrom

the oven.

PresstheCANCELpadto cancelthe beepsandremovethe

foodfromtheoven.Thecurrenttime ofdaywill appearinthe

displaywhenthe CANCELpadis pressed.

19 OVEN USE

Broiling is a method of cooking tender meats by direct heat. TO set oven to broil:

The cookingtime isdetermined bythe distance betweenthe 1. When the oven iscool, positionthe rack inthe oven.

meat andthe broilelement, thedesired degree of aloneness 2. Pressthe BROIL pad. and the thicknessofthe meat. 000 ° and BROIL indicatorwordswillappearinthe display.

Broiling Tips 3. Press the • pad to selectHI for normal broilingor press

Broilingrequires the use of a broiler pan and insert. The 4. For optimum browning results, remove the broiler pan broilerinsert mustbe inplacetoallowfat and liquidtodrainto and preheat the broil element for 3 minutes.

the pan below to prevent spatters, smoke and flare-ups. 5. Broilwiththe oven door opened to the broil stop position

Improper use may cause grease fires. (opened about 6-inches). Turn meat once abouthalfway For easier clean up, line the broiler pan with foil and spray through cooking. Check for doneness by cutting a slit in

the insertwitha non-stick vegetable spray.Do notcoverthe the meat nearthe center for desired color.

broiler insert with aluminum foil as this prevents fat from 6. At the end of cooking, removethe broilerpan and press

draininginto pan below, the CANCEL pad to cancel the broil operation. The Trim excess fat and slash remaining fat to help keep meat

from curlingand to reduce smokingand spattering.Season

meat after cooking. Use HI BROIL for most broil operations. Select Lo BROIL Place oven rack in the correct rack positionwhen oven is lowertemperature allowsfoodto cooktothe well done stage

cool. For darker browning, place meat closer to the broil without excessivebrowning.Cooking time will increase if Lo element.Place meat further down if youwishmeat tobe well BROIL is selected.

done or ifexcessive smokingor flaring occurs.

See Careand Cleaning Chart onpage 23 for instructionson Broil times will increase if oven is installed on a 208-volt

cleaning the broilerpan and insert, circuit.

the • pad to select Lo for lowtemperature broilihg.

current time of day willreappear inthe display.

when broiling longer cooking foods such as poultry.The

TYPEOF MEAT

BACON #4 WellDone 6to 10

BEEF STEAKS

1-inchthick #4 Medium 15to18

CHICKEN LO BROIL

Pieces #3 or#4 WellDone 30 to 45

FISH

Fillets #4 Flaky 8 to12 Steaks,1-inchthick #4 Flaky 10to 15

GROUNDBEEFPATTIES

3/4-inchthick #4 WellDone 15to18

HAMSLICE,precooked

1/2-inchthick #4 Warm 8to 12

PORKCHOPS

1-inchthick #4 WellDone 22 to26

* Thetoprackpositionis position#5.

** Broilingtimesareapproximateandmay varydependingonthemeat.

#4 Well Done 19to 23

CONTINUOUS CLEANING OVEN 20

CHATEAU RANGE CONVENTIONAL UPPER OVEN ONLY

Theupperovendoorlinerisporcelainenamel.Forcleaning effectively without some manual help. The crusty or

instructions,referto thecleaningchart on page24. varnish-like stainsthat formfrom these spilloversclog the

poresand preventthe special finishfrom being exposedto

the hot oven air. This greatly reduces the cleaning

effectivenessof the finish.

Thefinishofthe ContinuousCleaningOvenis identifiedby Thesecrustyor varnish-likestains musteither beremoved its dark gray color,and rough, porous texture.The rough orbroken up beforecleaningcan effectivelytake place.

texturepreventsgreasespattersfrom formingbeadswhich run down the walls leaving unsightly streaks. Rather,the roughtextureabsorbsspattersand allowsthem to spread,

thusexposingalargerareato thehotovenair.Thecatalyst,

whenexposedto heat,speedsthe oxidationof soil. Brushoff heavy soil with a nylon brush or plastic pad. DO

Cleaningactionautomaticallybeginswhenever theovenis areporousandparticlesofthesematerialswill ruboff onthe

turnedonfor bakingor roasting.TheovenMUSTbe "on"for walls.Rinseareawithclear wateronly.

cleaningtotakeplace.Nocleaningwilloccurwhentheoven Brittlecrustsor stainscan beloosenedbyGENTLYtapping is off. The specialcatalyticfinish must be exposed to hot stainwith awoodenor plasticutensil.Brushawayany loose

oven airbefore soilwillbeginto graduallyreducein size. soil that flakes off.Varnish type stains usually need to be

NOTUSEpapertowels,clothsor spongesforthe ovenwalls

softened with a small amount of water or damp cloth. Remaining soil will gradually reducewith continued oven useat normalbakingtemperatures.

The higherthe oven temperature,the faster the cleaning DO NOT USE ANY TYPE OF OVEN CLEANER,

action. The length of cleaning time will depend on these factors:Typeofsoil,amountorsizeofsoil,oventemperature PASTEON ANY CONTINUOUSCLEANING SURFACE.

and lengthoftimeoven is in use.Time mayvaryfrom afew ALSO,DONOTUSEANYABRASIVEMATERIALS,STEEL minutestoseveralhours.Soildepositedattheendofacycle WOOL, SHARP INSTRUMENTS OR SCRAPERS FOR

maystillbevisible.Thiswill usuallyfadewithcontinuedoven THEYWILL DAMAGETHE FINISH. use until the soilgraduallydisappearsor can bewiped up

manually.The oven will appear presentably clean, even Avoid spilloversby usingutensi_ thatare large enoughto thoughsomespattersmay be present, holdfood. A cookie sheet or piece of aluminum foil, just a

The special finish will clean most spatters during normal embossedrack supports.This is normal and resultsfrom oven use unless there is a heavy buildup of soil. Heavy slidingthe racksin andout ofthe oven.Wearmarkswill not spillovers suchas pieor casseroleboiloverswill not clean affectthe cleaningaction oftheoven.

POWDERED CLEANSERS, SOAP, DETERGENT OR

littlelargerthan thepan,can beplacedon the rackdirectly belowthe rack holdingthe utensilto catchspills.

Over a period of time, wear marks may appear on the

21 SELF-CLEAN OVEN

On Canadianmodelsonly: The SmoothtopCooktopwill ] notoperateduringa cleancycle.This isnormal. } Whenthe doorislockedandthe CLEANpadispressed,the

oven will automatically begin to heat to cleaning

The self-clean oven uses temperatures above normal temperatures. cookingtemperaturestoautomaticallycleantheentireoven

interior.

Onslide-in, drop-in andChateauranges:A fanwill auto-I

hotduringa cleancycle.Therefore,duringa clean cycle,I matca yturn off afterthe c eancyc e whenthe oven hasl

avoidtouchingthe cooktop,oven vent area, oven door cooled. CAUTION:It isnormalfor partsof the rangeto becomeI maticallyturnon duringthe self-clean cycleandwillauto-

andw ndow.

Itisbettertocleantheovenregularlyratherthanto waituntil indicatorwill appear in thedisplayto show that an internal there isa heavybuild-up of soil inthe oven. lock mechanismhas engaged.At this point,the oven door

Turnofftheovenlightbeforeacleancycle.Iftheovenlight is lefton, the light bulbwillburn out duringthe cleancycle. To preventdamagetothe doorand lock lever,do notforce

1. Removeovenracks. Closeandlock oven door. odor may be detected. This is normal and will lessen or

2. PressCLEANpad. broiler panwas accidentlyleft in theoven,smokeand odor

3. Pressthe A or • padto selectcleaningtime. may occur.

• Lightsoil - 2 hours

• Averagesoil - 3 hours Asthe ovenheatsandcools,youmay hearsoundsofmetal

• Heavysoil- 4 hours partsexpandingand contracting.This isnormaland willnot

As the oven reaches cleaning temperatures, the LOCK

cannot be unlockedand opened.

the dooropen whenthe LOCKindicatoris displayed., The first few times the oven is cleaned,some smoke and

disappearwith use. Ifthe oven is heavilysoiled, or if the

damageyourappliance.

Removebroilerpan,all pans and the oven racksfromthe oven.The racks will discolor and may not Slide easily Aboutone hourafterthe endofthe cleancycle,the internal

aftera clean cycle, lockwilldisengageandthe LOCKindicatorwillturnoff.At

thispoint,thedoorcanbe unlockedandopened.Movethe

Cleanovenframe,doorframeandaroundtheovenventwith doorlockleverto theleft orunlockedpositionandopenthe a non-abrasive cleaning agent such as Bon Ami or door.Theovenmaystill be hot.

detergentand water. These areas are not exposedto cleaningtemperaturesandshouldbecleanedtopreventsoil Somesoilmayleavealightgray,powderyashwhichcanbe

frombakingonduringtile cleancycle, removedwitha dampcloth.If soilremains,itindicatesthat

the cleancycle was not long enough.The soil will be

Wipeupexcessgreaseorspilloversfromtheovenbottomto removedduringthe next clean cycle. preventexcessivesmokingand flare-ups duringthe clean

cycle. If the oven racks were left in the oven and do not slide

smoothlyafteracleancycle,wiperacksand embossedrack

Wipeupsugaryspilloversandacidspilloverssuchaslemon supportswithasmallamountof vegetableoilto restoreease juice, tomato sauce or milk-based sauces. Porcelain of movement.

enamelis acidresistant,not acidproof.Theporcelainfinish maydiscolorifacidspillsare not wiped up immediately. Clean around the oven vent opening at the rear of the

cooktopifthere isadepositfromthefumesventedduringthe

Donot useoven cleaners onthe self-clean ovenfinishor clean cycle. Use detergent and water and a cloth or aroundanypart oftheovenastheywilldamagethefinishor non-abrasive pad.

parts.

Fine,hair-like linesmay appearin the oveninterioror oven

Topreventdamage,do notclean or rubthe gasketaround door.This isa normalconditionresultingfrom heatingand theovendoor.Thegasketis designedto sealinheatduring coolingof the porcelainfinish. These linesdo notaffectthe

thecleancycle, performanceofthe oven.

SELF-( ;LEAN OVEN 22

To set oven for a self-clean cycle: Todelaythe startof a cleancycle:

1. Removetheovenracksandclosethe door. 1. RemovetheovenracksandcUosethedoor.

2. Movethe doorlock leverto the right untilit restsinthe 2. Movethedoor locklever to the rightor lockedposition. lockedposition. 3. PressCLEANpad._

3. Pressthe CLEAN pad. 4. Pressthe• or • padto selectthe cleaningtime.

• "door"willappearinthe displayand beepswill sound ifthe door is notlocked. 5. PressSTOPTIMEorOVENSTOPpadand pressthe •

or• pad to selectthe time of day youwishthe ovento

• 3 HR:00willappear in the displayand SET CLEAN turn off.The stoptimeand CLEANDELAYSTOPTIME TIMEwillflash in thedisplay, willappearin the display.

• After a few seconds delay, the oven and fan will 6. Pressthe CLOCK padand the current time of day will automatically turn on. CLEAN TIME and ON will reappearinthe display.CLEANDELAYwillremaininthe remaininthe display, displayto showthat the ovenisset fora delayedclean

4. The ovenwillautomaticallycleanfor3hours.Or,select2 hoursforlightsoilupto4hoursforheavysoilbypressing 7. At the end of the clean cycle, continuous beeps will

the• or • pad. sound.Pressthe CANCELpad to cancelthe beeps.

5. Pressthe CLOCKpad and the current time of day will reappearinthe display.CLEANandONwillremaininthe

displaytoshowthat theovenisin aclean cycle. To cancelcleancycle:

Ifthedoorisnotlockedorthecleantimeisnotenteredwithin 1. PresstheCANCELpad.

30 secondsof pressingthe CLEANpad,the programwill automaticallybecancelled, forupto onehour.OncetheLOCKindicatorturns off,the

About one hour after the clean cycle ends, the LOCK doorcan be unlockedandopened. indicatorwillturn offandthe ovendoorcanbe unlockedand Ifthe LOCKindicatorisnotdisplayed,theovendoor can

opened, beunlockedand opened.

The oven door and door lock lever will be damagedif the

ovendoor Usforced toopen whenthe LOCKindicatorUsstill displayed.

operation.

2. IftheLOCKindicatorisdisplayed,allowtheoventocool

23 CARE AND CLEANING CHART

READ THE MANUFACTURER'S INSTRUCTIONS to be Mildly Abrasive Powder or Liquid Cleansers - Ajax,

sure the cleaner can be safelyused on this appliance. Also, Barkeepers Friend, Cameo, Comet, Soft Scrub.

read and carefully follow the manufacturer's directions when

using any cleaning product. Non-Abrasive or Scratchless Plastic or Nylon Scouring

To determine if a cleaning product is safe, test a small Scrunge Scrub Sponges, or Scotch-Brite No Scratch, inconspicuous area using a very light pressure to see Jfthe Cookware or Kitchen Sponge.

surface may scratch or discolor. This is particularly important for porcelain enamel, metal, plastic or highly polished, shiny, Abrasive Scouring Pads - S.O.S., Brillo Steel Wool Soap,

or painted surfaces. Scotch-Brite Wool Soap Pads.

Glass Cleaners - Don Ami, Cinch, Glass Plus, Windex. trademarks of the respective manufacturers.)

Pads or Sponges - Chore Boy Plastic Cleaning Puff,

(Brand names for the above cleaning products are registered

Dishwashing Liquid Detergents-Dawn, Dove, Ivory, Joy, Be sure appliance is off and all parts are cool before

Mild Liquid Spray Cleaners - Fantastik, Formula 409. If a part is removed, be sure it is correctly replaced.

Non-Abrasive Cleaners - Don Ami, paste of baking soda To prevent staining or discoloration, clean cooktop and water, after each use.

., PARTS , :::.....:. ; DIRECTIONS ......: .....

Enamel,baked or • Soap and water Usea drytowelor cloth to wipe up spills, especiallyacid (milk,lemonjuice, fruit,

painted • Mildliquid cleaner mustard, tomatosauce) or sugaryspills. Surface may discoloror dull if soil is not

• Backguard • Glass cleaner immediatelyremoved.This isespeciallyimportantfor white surfaces.

• Ovendoor Whensurface iscool,washwithwarm soapywater,rinse and dry.Forstubbornsoil,

• Sidepanels usemildlyabrasivecleaningagentssuchasbakingsodapasteor DonAmi.Ifdesired,

• Storagedrawer a thin coat of mild appliancewax can be used to protectthe side panels.A glass Enamel,po_;celain cleanercanbe used toadd "shine"tothe surface.

• Cooktop NOTE: Donotuseabrasive,causticor harshcleaningagentssuchassteelwoolpads

Broiler Panand • Detergentandwater Pretreatthe broilerpanandinsertwith a non-stick vegetablecoatingsuchas Pareor Insert, if equipped • Plasticor soap-filled scouringpad Mazolato makecleaningeasier.

• Dishwasher Removefromovenafteruse.Coolthenpouroffgrease.Placesoapyclothoverinsert

ControlKnobs • Detergentand water Forease ofcleaning,turnoff knobandremoveby pullingforward.Wash, rinse, and

• Mildliquid sprays dry.Do notuseabrasivecleaningagentsastheymay scratchthe finish and remove

• Glasscleaners the markings,Turn on each elementto be sureknobshave beencorrectlyreplaced.

Drip Bowls,Chrome

• Brownfood stains • Detergentand water Bowlscan permanentlydiscolorovertimeor if exposedto excessiveheator ifsoilis

I • P(asticscouringpads al(owedtobake on. The discolorationwillnotaffectthe cookingperformance.

• Mildabrasivecleaners Aftereach use, wash,rinse and dryto preventdifficultsoils. If heavily soiled,gently

• Blue/goldheat • FlitzMetalPolish Thesestainsare causedby overheating,and normallyoccurovera periodof time.

stains (Followpackagedirections) Theyare usuallypermanent.Tominimize:

Drip Bowls, • Detergentandwater Aftereachuse,wash,rinseanddryto preventdifficultsoils.Tocleanbyhand,soakin

Porcelain • Mildabrasivecleaners hotsudsywater,then usemildabrasivecleanerandplasticscouringpad.Porcelain

• Plasticscouringpads maydiscoloror craze overtime or if overheated.Thisis normal and willnot affect

• Dishwasher cooking performance.Do notcover with aluminum foil.

or oven cleaners.These productswill scratchor permanentlydamagethe surface. NOTE:Neverwipe a warmor hotsurfacewithadamp (:lothasthis maydamagethe

surfaceand maycause a steam bum.

andpan letsoakto loosensoil.Wash inwarmsoapywater.Usesoapfilledscouring

.padto removestubbornsoil.Broilerpan andinsertcanbecleanedinthedishwasher.

scrubwith plasticscouring pad.Ifsoil is allowedto burnon, it maybe impossibleto remove.

Donotcover withaluminumfoil.

1. Avoidexcessiveuse ofthe highheatsetting.Use HIGHonlyto startcooking,then lowerthe settingtofinish cooking.

2. Useflatbottom pansthat do notextend more thantwo inchesfrom the surface element.

Anon-abrasivemetal polishsuchas Ritzmaybe usedto helpremovestains.Flitzis availablein manyautomotivesupplyand hardwarestores.

handling or cleaning to avoid damage and possible burns.

CARE AND CLEANING CHART 24

• PARTS CLEANINGAGENTS DIRECTIONS ; ....

Elements, Elementsare self-cleaning.Soilwillburnoffaselementsareused.Donotsprayoven Ovenand Coil cleaner on elements,electricalhook up or connection. Do not immerse ceil-type

Glass I • Detergentandwater Topreventstainingof the ovenwindow,avoidusingexcessiveamountsof water

• Ovenwindow • Glasscleaner whichmay seepunderorbehindglass.Washwith detergentand water.Remove

Metalfinishes • Soapand water Washwith soap and water or a glass cleanerand a soft cloth. NOTE: Toprevent including brushed • Glasscleaner scratchingor dullingofthefinish,donotusemildlyabrasive,abrasive,harshorcaus- aluminumand • Plasticornon-abrasivepad or ticcleanersorovencleaners.

chrome sponge Tocleanbrushedaluminumbackguard:Useonlysoapandwaterorasoftclothand

• Backguard glasscleanertopreventscratchingordulling.

• Cooktop

• Doorhandle Tocleanstubbornsoilonthebrushedchromecoektop or door: Useapasteofbak-

• Manifold panel ingsodaandwateranda sol_cloth.Rubwiththegraintopreventscratching,dullingor

• Ovendoor streakingof the surface. Torestore lusteror toremovefingerprints,use a soft cloth

• Storagedoor andmineral oil. Remove excess with a cleancloth.Or, clean withan automative

• Trimparts chromecleaneror polisher.

Oven Interior • Followinstructionson page20 for Wipe up all spillsimmediatelywitha dry cloth- especially acidspills (milk,fruits,

OvenRacks • Detergentandwater "Cleanwithsoapywater.Removestubbornsoilwithcleansingpowderorsoapfilled

PlasticFinishes ,, Soapandwater Whensurfaceiscool,cleanwithsoapandwater;rinse,anddry.Use a glasscleaner

• Doorhandles • Non-abrasiveplasticpad orsponge and a soft cloth.NOTE: Never use ovencleaners, abrasiveor causticliquidor

• Backguardtrim * Glasscleaner powderedcleansersonplasticfinishes.Thesecleaningagentswill scratchormarr

• Knobs finish.NOTE:Topreventstainingordiscoloration,wipeupfat,greaseoracid(tomato,

• Endcaps lemon,vinegar,milk,fruitjuice,marinade)immediatelywithadrypapertowelor cloth. Porcelain Enamel • Detergentandwater Porcelain enamel is glass fused on metal and may crack or chip with misuse.

• Cooktap,coil • Pasteof bakingsodaand water Porcelainenamelisacid resistant,notacidproof.All spil_overs,especiallyacidicor elements • Non-abrasive plasticpad or sugarspillovers,should bewiped upimmediately with adrycloth. This is especially

• Cooktoptrim, sponge importantaround the vent opening for smoothtop cooktop models. Surface may

smoothtop discoloror dullif soil,especiallyacidic soil,is notremoved.Neverwipeoffawarmor

• Doorlineron Chateau hotsurfacewithadampcloth.Thismaycausecrackingandchipping.Neveruseoven upperoven cleaners,abrasiveorcausticcleaningagentson exteriorfinishofrangeorintheSelf-

SmoothtopCooktop

• Lightto moderate • CooktopCleaningCreme Wait untilcooktophascooledbeforecleaning,Gentlyapplycleaningagent witha soil * Detergentandwater non-abrasiveplastic brush,nylonor plasticpad,paper towel orclean cloth.Rinse

theContinuousCleanOven. tomato,etc.). Neverwipe a warmorhotsurfacewitha dampclothas crackingand

• Followinstructionsonpages21-22 chippingmayresult. for Self-CleaningOven.

• Plasticscouringpad scouringpad. Rinse anddry. Rackswfll permanentlydiscolorand may notslide'

• Cleansingpowders smoothlyifleftintheoven duringaself-clean operation.Ifthisoccurs,wipetherack

,,Soap-filledscouringpads andembossedracksupportswitha smallamountofvegetableoilto restoreease of

• Pasteof bakingsoda and water thoroughlyandcompletelydry.

surfaceelementsJnwater.

stubbornsoilwithpasteofbakingsodaandwater.Donotuseabrasivematerialssuch asscouringpads,steelwoolorpowderedcleaningagents.Theywilldamageglass. Rinsewithclear wateranddry.

movement,thenwipeoffexcessoil.

cleanor ContinuousCleanOven,

• Heavysoilorbrown/ ,,CooktopCleaningCreme Gentlyscrubwithcleaningcremeandcleanclothorpapertowel.Reapplycleaner.

graystainsfrom Coverwithdamppapertowelstokeepcleanermoist.Letstandfor30to45 minutes. hardwateror metal Scrubtoremoveremainingstain.Rinseanddry.

marks

• Burned-onor crusty • Single-edge safetyrazor blade Hold razor blade scraper at 30° angle and very carefully scrape off soil. Clean soilsorresidue * Cook'topCleaningCreme remainings0il withcleaningcreme.

• Sugar,plastic, • Single-edge safetyrazorblade Immediatelyturnelementto LOW and scrapefromhotsurfaceto a coolarea.Then

aluminumfoil heldwith a pothofderor awooden turn element OFF and cool. Clean residuewith razor bladescraperand cleaning

handledstainlesssteelspatula creme,

NOTE:Callanauthorizedservicerifthesmoothtopshouldcrack,breakorifmetalor aluminumfoilshouldmeltonthecooktop.

25 MAINTENAN(:E

Before replacing the light bulb or fluorescent tube, DISCONNECTPOWERTO RANGE.Besure thebulbis Onconventional upperoven:Toturnonlight,pressbutton

cool.Donot toucha hotbulbwithadampclothasthe bulb marked"BACKPANEL"whichislocated at the baseof the

maybreak, controlpanel.

On microwave oven model: To turn on light, press"ON" pad locatedat base of microwavecontrol panel.

Toturn oncooktop light: Pressandholdrockerswitchuntil

the light turns on. The oven light switchis located on the Toreplace fluorescent panel,light: Be sure bulb is cool.

backguard. Removethree screwsholdingtrim piecealongtop edgeof

glassOR two screwsholdingtrimpiecealong sideedgeof

Toreplacecooktop light:Besure bulbiscool.Graspthe glass.Supportglasswhileremovingscrewssoglasswillnot toptrimof thebackguardwithyourthumbsunderthefront fallforward.Removebulbandreplace.Reconnectpowerto

edge and pull outward while lifting to release trim from catchesat eachend. andreset the clock.

range,check lightoperationprior to replacing glasspanel

On microwave oven model: Refer to the sepa#ate microwaveoven use and care booklet for instructionson

removingthe cooktoplight bulb.

Remove fluorescent tube and replace with an 18 watt fluorescent tube. Snap top trim back into place and reconnectpowerto range.Resetthe clock.

Toturnonovenlight:Pushthe rockerswitchlocatedonthe On conventionalovenonly:Toturn onoven light,pushin backguardoronthecontrolpanel, button,locatedatbase of controlpanel.

To replace oven light: Be sure bulb is cool.Use a dry potholder,to preventpossibleharm to hands,and very On microwave oven: Oven lightturns on wheneverthe

carefullyunscrewbulbcoverandbulb. dooris openedor when theoven is in a cookor defrost

operation.

..... Useadrypotholderandverycarefullyremovebulb.Replace

witha 40watt APPLIANCEbulb.Reconnectpowerto range

''__J/}_t Toreplaceconventionalovenlight:Besurebulbiscool.

Replacewith a 40 watt appliancebulb. Replacebulbcover microwave oven use and care booklet for instructions on andreconnectpowerto range.Resetthe clock, removingthe oven light bulb.

and resetthe clock.

On microwave oven model: Refer to the separate

MAINTENAN(;E 26

To remove lift-off door:Whencool, openthe door to the "stop"position(openedabout6inches)andgraspthedoor

To preventstainingor discoloration,clean cooktopafter at eachside.Donotusethedoorhandletoliftthedoor.Lift eachuse.Wipeacidorsugarstainsassoonasthecook-top upevenlyuntilthedoorclearsthehingearms.

has cooled as these stains may discoloror etch the

Freestandingrangeswithacoil elementcooktopwillfeature

a lift-up cooktop.

Smoothtop cooktops, slide-in or drop-in ranges and

I Cooktops on the following models do not lift up:

rangesfor Canada.

porcelain, i_ Toraise thecooktop: Whencool,grasp the frontedge of

thecooktopandgentlyliftup untilthetwosupportrodsat the Toreplacedoor:Graspthedoorat eachside,align slotsin frontof the cooktopsnapinto place, the door with the hingearms and slidethe door downonto

the hingearmsuntilit iscompletelyseated on hinges.

not movethe doorlock leverto the rightor lockedposition

Theoven doorislockedfor a self-clean operationonly.Do

L_ I\ during a cooking operation. If the door is locked, the

operation will automatically be cancelled and "door" will appearinthedisplay.Ifthe ovenishotenoughtoengagethe internallock,the oven door will not open.Allow the ovento coolfor up to an hour,then unlockand openthe door.

To lower the top: Holdthe front edgeof the cooktopand

carefully push back on each support rod to release the notchedsupport.Then gently lowerthe top intoplace.The

supportrodswill slideintothe rangeframe. The storagedrawerat the bottomof the rangeis safe and

convenientfor storingmetaland glasscookware.DONOT storeplastic, paperware,foodorflammable materialinthis drawer.Removedrawerto clean underrange.

Do not place excessive weightonan openoven door or Toremove: Emptydrawerthen pulldrawer outto the first stand on an open oven door as, in some cases, it could stop position.Liftupfront of drawerand pull tothe second causethe rangeto tipover,breakthedoor or causeserious stop position. Grasp sides and lift up and out to remove

injurytothe user. drawer. When openingthe ovendoor,allow steam and hot air to Toreplace: Fitthe endsof thedrawerglides ontothe rails.

escape before reachingin ovento check, add or remove Liftup drawerfront andgently pushin to first stopposition. food. Lift up drawer again and continue to slide drawer to the

Do not attempt to open or close door until the door is completelyseated on the hinge arms. Never turnon the ovenunlessdoorisproperlyinplace.Whenbaking,besure

thedoo_:iscompletelyclosed.Bakingresultswillbeaffected

CAUTION: Hinge arms are spring mounted and will Levelinglegsarelocatedon slam shut against the range if accidently hit. Never each corner at the base of

place hand or fingersbetween the hingesand the the range.Levelbyturning

ifthe dooris not securelyclosed, rangeS°reeFerproperfl°°rSmustarebaking,ben°tlevel.level'y°ur__

frontoven frame.Youcouldbe injuredffhingesnaps the legs. To prevent range _ back. from accidently tipping,

closedposition.

range should be secured to the floor by sliding a rear

levelinglegintotheanti-tip bracketsuppliedwiththe range.

27 SERVI(;E INF()RMATION

Your appliance is equippedwith self-diagnostic software If you have carefully followed the recipe, reviewed the whichcontinuouslymonitorsthe controlto ensuresafeand bakingtipsinthismanualandstillfeel cookingresultsdonet

properoperation. If the software detects a questionable meet your expectations, you can adjust the ov6n

situation,a FAULTCODE (Fplusa number)will appear in temperature. DO NOT ADJUST THE TEMPERATUREif the display,continuousbeeps maysound and as a safety only one ortwo itemsare not bakingproperly.

precaution,the operationwill be cancelled. If you think the oven should be hotter or cooler,you can If afault codeappearsin the displayand continuousbeeps adjust it yourself. To decide how much to change the

sound, press the CANCEL pad. Then, reprogram the thermostat, setthe oven temperature25°F higheror lower cookingoperation.Ifthefault codereappearsinthe display, thanthe temperaturein yourrecipe,then bake.The results

call an authorizedservicer. Do notuse the oven untilthe ofthe '_est"shouldgiveyouan idea of howmuchto adjust appliance hasbeen serviced, the thermostat. .

Toadjust the thermostat:

Iftheovenisheavilysoiled,excessivesmokeandflaringI mayresultinafaultcodeduringa self-clean cycle.IfthisI 2. Pressthe • paduntil 550° isdisplayed.

occurs,presstheCANCELpadandallowtheoventocool for anhour. l 3. Press and hold the OVEN TEMP pad for several

PresstheOVENTEM

seconds. The display will show the ambient oven temperatureforafewsecondsthen00°willappearinthe

display.

• If 00° does not appear in the display, press the

CANCELpadand beginagain.

• If the oventemperaturewas previouslyadjusted,the change will be displayed. For example, if the temperature was reduced by 15°, -15 ° will be

displayed.

4. Pressthe • or• pad to selectthe temperaturechange desired.

• The oventemperature can be increasedupto 35° or reducedby as much as 35° (-35°) in5° increments.

• Ifyoudelayinselectingatemperature,theprogramwill automatically cancel and 00° will disappear. Begin

againif the programcancels.

5. Pressthe CANCELpadandthetime of daywill reappear in the display.The ovenwill nowbake at the adjusted temperature.

pad.

It is not necessaryto readjust the oven temperature if there is a power interruption.This adjustmentwill not affect broilor cleantemperatures.

SERVICE INF()RMATI( )N 28

Partor all of your electricrange doesnot operate Baking resultsdiffer from previousoven

• IstherangeplugIooseordisconnectedfromtheelectrical • Oventhermostatcalibrationmay differbetween old and

outlet? new oven. The newer oven thermostat may be more

accuratethan the one on your previousoven. Followa

• Are any housefuses blownor circuitbreakerstripped? reliablerecipeandreviewbakinginformationonpages14

• Hasthe power supplyto the homebeeninterrupted? to 15.Ifyoustillfeel theoventemperatureisincorrectsee

• Are the ovencontrols properlyset?

• Wastheelectroniccontrolcorrectlyset? Fooddoes notbroil correctly

• Was the door left in the lockedpositionfollowinga • Wasthecontrolset properlyforbroiling?(See page19.) self-cleancycle? • Wasthe properrackpositionused?(See page19.)

• Isthe ovensetforautomaticovencooking? • Didyouallowtimeforthe broilelementto preheat?

Surface elements fail to turn on or heat the food slitsforfatdrainage?

properly.

• Isthe rangeplug looseordisconnectfromthe electrical

outlet? Oven lightdoes notoperate

• Ifthe rangehascoilelements,aretheyproperlyplugged • Isthebulblooseor burnedout? intothe receptacles?

• Wereappropriateutensilsused?(Seepage6,)

page27forinformationon adjustingthe oventhermostat.

• Wasaluminumfoilusedonthebroilerinsert,blockingthe

• Wastheovendooropenedto thebroilstopposition?

• Is the lightswitchinthe Onposition?

• Arethesurfaceelementcontrolsproperlyset? Ovenwill notself-clean

• Is voltagetothehousereduced? • Istheself-cleancontrolsetpropedy?(Seepages21-22.)

• CANADIANMODELSONLY:Thesmoothtopcooktopwill • Isthe ovensetfor a delayedcleanoperation? notoperateduringa self-cleanoperation.Thisisnormal. • Isthe ovendoorproperlylocked?

Foodnot bakingor cooking correctly

• Aretheovenracksproperlyplacedforbaking? Oven doorwill not lock

• Haveyouusedaluminumfoilcorrectly? • Are the controlsproperlyset forthe self-clean cycle?

• Was the oven preheatedas recommended?

• Are thecontrolsproperlyset? • Hastheself-cleancyclebeencompletedforat leastone

• Isthere1to2inchesofspacebetweenpansandtheoven hour?

walls? • Wasthe doorcorrectlyunlocked?

• Aretherangeand ovenrackslevel? • Isthe LOCKindicatorwordinthedisplay?

• Was goodcookware/bakewareof the propersize used?

• Was the oven vent coveredor blockedon the range surface? • Thisisa faultcode.Ifafaultcodeappearsinthedisplay

• Are youusinga testedrecipefroma reliablesource? andacontinuousbeepsounds,pressthe CANCELpad.

• Haveyouusedaluminumfoilcorrectly? page27 foradditionalinformation.

• Wastheovenheavilysoiled?

Oven door will notunlock

"F" plus a numberappears in thedisplay

Ifthe beepscontinue,callan authorizedservicer.See

29 SERVI(:E INF(IRMATI()N

Do notattempt toservicethe applianceyourself unless address, phone number, the complete model and serial

directedtodo sointhis manual.Contactthedealerwho numbersofthe appliance,the name and addressof the

sold you the appliance for service or call us. Our dealerfromwhomyoupurchasedtheappliance,thedateof

telephonenumber is found on the separatewarranty purchaseand detailsconcerningyourproblem. sheet.

Ifyoudo notreceivesatisfactoryservice,youmaycontact

If your appliance should require service or replacement the Major ApplianceConsumerAction Program by letter.

parts,contactyourdealeror authorizedservicer.Be sureto Includethe informationlisted above. have the model and serial numbers of the appliance MajorApplianceConsumerAction Program

available.Seethe frontcover of this manualfor locationof 20 NorthWacker Drive

these numbers.Pleasereviewthe separatewarrantysheet Chicago,iL 60606 that comeswith your applianceto see if the serviceyou are

requestingiscoveredbythe warranty. MACAP(MajorApplianceConsumerAction Program)isan "

independentagencysponsoredbythree tradeassociations

Ifyouarenotsatisfiedwiththelocalresponsetoyourservice as a court of appealson consumercomplaintswhich have requirements,writeto MaytagCustomerService,P.O,Box notbeenresolvedsatisfactorilywithinareasonable3eriodof

2370, Cleveland, TN 37320-2370. Include your name, time.

Magic Chef 3888WVS, C6892XVS Owner's Manual

Specifications and Main Features

Frequently Asked Questions

User Manual