Iwill VD133PL, VD133Pro VD133PL/VD133Pro User Manual

Contents
Chapter 1 Quick Installation .................... 3
1.1 Layout ......................................................................................3
1.2 CPU setting..............................................................................4
1.3 Jumpers .................................................................................... 4
1.5 Connectors ............................................................................... 9
1.6 Form Factor ...........................................................................16
Chapter 2 Overview................................. 17
2.1 What is RAID?.......................................................................18
2.2 What is IDE RAID?............................................................... 18
Chapter 3 Features.................................. 20
3.1 Motherboard Components Placement..................................20
3.2 Back Panel .............................................................................22
3.3 Block Diagram ....................................................................... 23
3.4 Specifications ......................................................................... 24
Chapter 4 Hardware Setup..................... 26
4.1 Before Installation................................................................. 26
4.2 Jumper setting ....................................................................... 26
4.3 Install the Processor.............................................................. 29
4.4 Install Memory Modules ....................................................... 33
VD133 Pro\ VD133 PL Ver1.2A
1
FB11342310000
Chapter 1 Quick Installation
4.5 Install PCI Expansion Cards ................................................. 34
4.6 Usage of the AMR slot.......................................................... 35
4.7 Usage of the AGP slot...........................................................35
4.8 Connect Devices and Power Supply ..................................... 36
Chapter 5 BIOS Setup............................ 48
5.1 Introduction............................................................................48
5.2 Main Menu ............................................................................. 49
5.3 Standard CMOS Features .................................................... 50
5.4 Advanced BIOS Features ..................................................... 53
5.5 Advanced Chipset Features .................................................. 57
5.6 Integrated Peripherals .......................................................... 60
5.7 Power Management Setup.................................................... 65
5.8 PnP/ PCI Configurations....................................................... 69
5.9 PC Health Status ................................................................... 72
5.10IWILL Smart Setting ........................................................... 72
5.1 1Load Fail-Safe Defaults ....................................................... 73
5.12Load Optimized Defaults..................................................... 74
5.13Set Supervisor / User Password Setting ............................. 75
5.14Save & Exit Setup ................................................................ 75
5.15Exit Without Saving ............................................................. 75
Chapter 6 Power Installer CD................ 76
6.1 Software Installation ............................................................. 76
6.2 How to use the Power installer CD ...................................... 76
6.3 Installing Operating Systems................................................ 78
2
VD133 Pro Series
Chapter 1 Quick Installation
Chapter 1
Quick Installation
Several easy installation steps will be described in this chapter to help the experienced users with quick installation. If you are a beginner, or need to know more about this product, please refer to Hardware Setup.
1.1 Layout
VD133 Pro Series
3
Chapter 1 Quick Installation
1.2 CPU setting
This motherboard is designed for Intel® Pentium® III, and Celeron™ through a Socket 370 connector.
CPU Model Vcore & Package “CPU Speed” in BIOS
Celeron 300A 2.0V, PPGA 300Mhz(66x4.5) Celeron 333 2.0V, PPGA 333Mhz(66x5) Celeron 366 2.0V, PPGA 366Mhz(66x5.5) Celeron 400 2.0V, PPGA 400Mhz(66x6) Celeron 433 2.0V, PPGA 433Mhz(66x6.5) Celeron 466 2.0V, PPGA 466Mhz(66x7) Celeron 500 2.0V, PPGA 500Mhz(66x7.5) Celeron 533 2.0V, PPGA 533Mhz(66x8) Pentium III 500E 1.60V, FCPGA 500Mhz(100x5) Pentium III 550E 1.60V, FCPGA 550Mhz(100x5.5) Pentium III 600E 1.65V, FCPGA 600Mhz(100x6) Pentium III 650E 1.65V, FCPGA 650Mhz(100x6.5) Pentium III 700E 1.65V, FCPGA 700Mhz(100x7) Pentium III 533EB 1.60V, FCPGA 533Mhz(133x4) Pentium III 600EB 1.65V, FCPGA 600Mhz(133x4.5) Pentium III 667EB 1.65V, FCPGA 667Mhz(133x5) Pentium III 733EB 1.65V, FCPGA 733Mhz(133x5.5) Pentium III 650E 1.65V, FCPGA 650Mhz(100x6.5) Pentium III 700E 1.65V, FCPGA 700Mhz(100x7) Pentium III 533EB 1.65V, FCPGA 533Mhz(133x4) Pentium III 600EB 1.65V, FCPGA 600Mhz(133x4.5) Pentium III 667EB 1.65V, FCPGA 667Mhz(133x5) Pentium III 733EB 1.65V, FCPGA 733Mhz(133x5.5)
1.3 Jumpers
1.3.1 JP1 (CMOS) Clear CMOS jumper
The jumper is for BIOS setting value.
4
VD133 Pro Series
Chapter 1 Quick Installation
1.3.2 JP9(Vcore+) CPU core voltage select jumper
This function offers adjustable processor Vcore. When NO jumper caps are used, the motherboard automatically generates the proper Vcore voltage that requested by the CPU. Place the jumper cap over pins 1-2 to increase 5% more voltage to the processor’s Vcore. Place the jumper cap over pins 2-3 to increase 10% more voltage to the processor’s Vcore.
1.3.3 JP10(VIO) VIO select jumper
This jumper is used to select the VIO voltage.
VD133 Pro Series
5
Chapter 1 Quick Installation
1.3.4 JP13 (AC 97) AC97 Codec Enabled / Disabled jumper
This jumper is used to enabled / disabled the onboard audio CODEC.
1.3.5 JP70(VD133 Pro only)
This jumper is used to disable/enable the IDE RAID function.No jumper cap is used to disable IDE RAID.
6
VD133 Pro Series
Chapter 1 Quick Installation
1.4 Expansion Slots / Sockets
1.4.1 J1(Socket 370) Processor socket
1.4.2 J3—J5 (DM0—DM2) 168-Pin DIMM Sockets
Install memory in any combination as follows:
VD133 Pro Series
0
7
Chapter 1 Quick Installation
Location Support Module Type
Single-Side Module DM0 Double-Side Module Single-Side Module DM1 Double-Side Module Single-Side Module DM2 Double-Side Module
Total System Memory (Max1.5 GB)
1.4.3 J12J16 (PCI 1PCI 5) PCI expansion slots
The connectors are Bus Master PCI Expansion Slots.
1.4.4 J27 (AMR) AMR Slot
8
VD133 Pro Series
Chapter 1 Quick Installation
1.4.5 J11 (AGP) AGP Slot
1.5 Connectors
1.5.1 J28 (IDE0) Primary ATA/66 IDE channels
1.5.2 J29 (IDE1) Secondary ATA/66 IDE channels
VD133 Pro Series
9
Chapter 1 Quick Installation
1.5.3 J65(IDE2) The Third ATA/66 IDE channels(VD133 Pro only)
1.5.4 J66(IDE3) The Fourth ATA/66 IDE channels (VD133 Pro only)
1.5.5 J30 (FDC) Floppy connector
10
VD133 Pro Series
Chapter 1 Quick Installation
1.5.6 J37 ATX power connector
1.5.7 J39(FCPU)&J41(FSYS)
fan connectors on this motherboard. The J39 (FCPU) is designed to support CPU fan; the J41 (FSYS) is for system fan used .
VD133 Pro Series
11
Chapter 1 Quick Installation
1.5.8 J4 3
This connector is composed of all the headers that may be connected to the front panel of the chassis.
1.5.9 J45 (IR)
This connector is designed for the SIR devices.
12
VD133 Pro Series
Chapter 1 Quick Installation
1.5.10J46 (WOL)
This is the W ake-on-LAN connector. In order to wake up the system through a plug­in network card, the card must provide a high active wake signal.
1.5.11J46(MODEM)
VD133 Pro Series
13
Chapter 1 Quick Installation
1.5.12J48(SMBUS)
1.5.13J54 (CD_IN)
The audio output can be transfered from CD-ROM to the audio system This connector can be connected for mid-to-low speed devices such as mice,
keyboards, joysticks,etc.
14
VD133 Pro Series
Chapter 1 Quick Installation
1.5.14J54A (USB1)
The motherboard provides four USB support for the commonly found USB devices now a days. The motherboard has two USB ports onboard. The extra two USB support can only functionable with the additional USB riser kit.
VD133 Pro Series
15
1.6 Form Factor
Chapter 2 Overview
16
VD133 Pro Series
Chapter 2 Overview
Chapter 2
Overview
Thank you for purchasing the IWILL VD133 Pro series motherboard. This operation manual will instruct you how to configure and install the system properly. It contains an overview about the engineering design and features of this product. Also, this manual provides useful information for later upgrades or configuration changes. Keep this for your future reference.
About This Manual
This manual will introduce to the user how this product is installed. All useful information will be described in later chapters. Keep this manual for future upgrades or system configuration changes.
Chapter 1 Quick Installation The quick reference for experienced user Chapter 2 Overview An overview of this motherboard Chapter 3 Features Information and specifications Chapter 4 Hardware Setup Information for setting up the motherboard Chapter 5 BIOS Setup Information for setting up the system BIOS Chapter 6 Power Installer CD Information for the Power Installer CD
Item Checklist Y ou should find the following components when opening the box: [Ô] Iwill motherboard [Ô] This operation manual [Ô] Two 40-pin ATA/66 cable with three heads [Ô] One 34-pin Floppy cable with four heads [Ô] One Iwill Power Installer CD [Ô] Thermal Sensor for System [Ô] One RAID utility CD diskette
Optional
[ ] Thermal Sensor for HDD [ ] One USB riser kit [ ] One Infrared port cable [ ] One Driver Diskette [ ] Iwill SIDE-RAID66 PCI AT A/66 IDE controller [ ] Iwill SIDE-2930C PCI Fast SCSI controller [ ] Iwill SIDE-2930U+ PCI Ultra SCSI controller [ ] Iwill SIDE-2936UW PCI Ultra W ide SCSI controller [ ] Iwill SIDE-2935L VD PCI Ultra2 SCSI controller [ ] Iwill SIDE-DU280 PCI Dual channel Ultra2 SCSI controller [ ] Iwill SIDE-DU3160 PCI Dual channel Ultra160 SCSI controller [ ] MR card
VD133 Pro Series
17
Chapter 2 Overview
Introduction
The VD133Pro motherboard is the most flexible platform in todays market based on the HPT368 chipset support IDE RAID function. A major advancement in chipset technology, VIA 694X chipset support PC66/PC100/PC133 SDRAM.(VD 133 PL doesnt suposrt IDE RAID function)
This motherboard supports Intel/Cyrix/Katmai/Cumine processors. It can support the processors that packed as a PPGA or FCPGA type. In other words, no matter what kind of processors you have, the VD133Pro / VD133 PL motherboard always provides you an adequate solution.
What is RAID?
RAID stands for Redundant Array Independent Disk, it was developed by a group of scientists at University of California at Berkeley in 1987. The scientists investigated using small disk drivers clustered into an array and compared the performance and cost of this type of storage configuration to the use of a Single Large Expensive Disk (SLED), commonly found in mainframe application. The conclusion was that arrays of smaller and less expensive disks out performed the performance of the SLED.
However, disk performance is not the only requirement in todays Information Technology market. As more network storage capacity expands, the more critical it becomes to safely backup the data in the disks. While tape or MO backup meets the recovery requirements, it does not ensure the continuous availability and data integrity necessary to keep your system up and running. To solve this, the scientists proposed five types of redundant array architectures, known as RAID level 1 through 5. Each RAID level defines hoe redundancy is achieved and data is distributed across the drives I the array.
What is IDE RAID?
RAID was associated with SCSI interface only in the past. The capital outlay generally puts people out of the door. This situation is about to change with the introduction of IWILL VD133 Pro. A high performance IDE RAID host adapter, with Ultra AT A66 interface. The SIDE RAID66 of fers RAID 0 (Striping), RAID 1 (Mirroring) and RAID 0+1 (Striping + Mirroring) functions, and supports the Ultra ATA 33/66 hard disks commonly found in the market today.
18
VD133 Pro Series
Chapter 2 Overview
Copyright
This manual contains information protected by copyright law. All rights are reserved. No part of this document may be used or reproduced in any form or by any means, or stored in a database or retrieval system without prior written permission from Iwill Corporation.
Trademark
Intel® / Pentium® / Celeron are trademarks of Intel Corporation. Iwill and Iwill logo are trademarks of Iwill Corp. All other product names are trademarks and registered trademarks of their respective owners.
Warning
Most of the features of this product have passed strict verification tests, and are subject to change at any time without prior notice. If any malfunction occurs due to the future technical changes made by the respective component manufacturers, Iwill assumes no responsibility or liability for it.
Notice
Information furnished in this manual is believed to be accurate and reliable. However, Iwill Corporation assumes no responsibility for its use, nor for any infringements of patents or other rights of third parties which may result from its use. Iwill Corporation reserves the right to change product specifications at any time without notice. Applications described in this document for any of these products are for illustrative purposes only. Iwill Corporation makes no representation nor warranty that such applications are suitable for the specified use without further testing or modification. Iwill Corporation assumes no responsibility for any errors that may appear in this document.
We
IWILL Corporation
No. 10, Wu Chuan 3rd Rd., Hsin Chuang City, T aipei, Taiwan, R.O.C. Declare under sole responsibility that the
VD133 Pro series motherboard Meets the intent of Directive 89/336/ECC for Electromagnetic Compatibility. Compliance was demon­strated to the following specifications as listed in the official Journal of the European Communities:
EN 50081-1 Emissions:
EN 55022 Radiated, Class B
EN 55022 Conducted, Class B
EN 60555-2 Power Harmonics
EN 50082-1 Immunity:
I EC 80 1-2Electrostatic Discharge
IEC 801 -3RF Radiate
IEC 801-4Fast Transient
VD133 Pro Series
19
Chapter 3 Features
Chapter 3
Features
This motherboard are well designed for the user. Who wants the most stable plat form, best perform­ance/price ratio and convenience.
3.1 Motherboard Components Placement
20
VD133 Pro Series
Chapter 3 Features
The following are part descriptions for the motherboard parts shown on the opper page.
1: ATX Power Connector
2: Socket 370 Connector
3: VIA 82C694X Chipset
4: Three DIMM Sockets
5: Floppy Connector
6: Primary and Secondary IDE Connectors
7: AGP slot
8: VIA 82C686X Chipset
9: HighPoint HPT368 Chipset (VD133 Pro only)
10: The Third IDE Connector (VD133 Pro only)
11: The Fourth IDE Connector (VD133 Pro only)
12: Programmable BIOS
13: 32bit/33MHz Bus Master PCI Slot
14: AMR Slot
15: Joystick, Midi Line Out ,Line in, Microphone In Connector
16: COM1Connector
17: Parallel Connector
18: COM2Connector
19: USB1 Connectors 20: PS/2 Mouse, PS/2 Keyboard Connector.
VD133 Pro Series
21
3.2 Back Panel
Chapter 3 Features
22
VD133 Pro Series
Chapter 3 Features
3.3 Block Diagram
VD133 Pro Series
23
Chapter 3 Features
3.4 Specifications
Processor
Support unique CPU throught Socket370 socket (Reserved Socket418 space). Support Intel/Cyrix CPU. Support Katmai/CuMine CPU. Support CPU speed from 300 MHz up to 466 MHz or hight. Support H/W setting and S/W adjustable (Jumper-free) method. SupportSoftware assign ext. frequency(All frequency that Clock Gen provided). SupportSoftware assign CPU Multipier from 2X to 8X
ChipSet
VIA Apollo Pro133A Support 66/100/133 MHz system Bus Frequency
Main Memory
Supports three DIMM sockets Support PC66/PC100/PC133 SDRAM Support 16M/64M/256M/512M SDRAM technology Maximum memory up to 1.5GB/768MB when using 256M/64M-16M tecnology. Support Suspend to Ram Support 3.3V Unbuffered/Registered DIMM Support Singel-Sided/Double-sided DIMMs Support ECC memory module
Bus Master IDE
Supports 2 channel IDE interface up to 4 IDE Devices. Supports Ultra DMA Bus Master with 66 MB/s burst data transfer rate. Supports PIO mode up to Mode 4. Supports LS120/Zip drive.
Multi-IO
Provides one floppy port to support 1.2M/1.4M/2.8M/3 mode FDD and QIC-80 tape drive Supports two high-speed 16550A serial ports Supports one ECP/EPP parallel ports Supports one PS2 mouse port Supports one PS2 keyboard port Provides One Game/MIDI port to support two joysticks Supports one SIR port Supports PS2 mouse and PS2 keyboard
24
VD133 Pro Series
Chapter 3 Features
USB
Supports 4 UHCI Universal Serial bus Port
Expansion Slots
Three DIMM sockets One Universall AGP Slot Five 32bit/33 MHz Bus Maser PCI Slots One AMR Slot One AGP Slot
Sound on board
Support AC97 2.1 Digital Link
Management
H/W monitoring +5V, Vcore, VTT , V io Vsb voltage Supports Power on by Lan/Ext. Modem/Int. Modem/Keyboard/Alarm Supports ACPI Blinking LED Supports BIOS ROM Flash Control (S/W protection) Supports AC-Loss Recovery(Former status/OFF) Supports Suspend to RAM Supports suspend to Disk
BIOS
Support 2M flash ROM Support Plug & Play Supports APM 1.2 Supports DMI 2.1 Supports ACPI 1.0 Y ear2000 compliance
Others
A TX Form Factor 30.5 x 18.8
VD133 Pro Series
25
Chapter 4
Hardware Setup
4.1 Before Installation
For installation, you may need some or all of the following tools: Medium size flat blade screwdriver Medium size Phillips head screwdriver A 3/16 inch nut driver or wrench
Users must follow these guidelines to ensure the motherboard is protected during installation. a. M ake sure your computer is powered-off whenever working with inside
components.
b. The motherboard, like all other electronic equipment, is sensitive to
static. Please take the proper precautions when handling it. If possible, ground yourself by touching a metal table or desk. keep the board in its conductive wrapping until it is configured and ready to be installed in your system.
c. Keep all magnets away from both your hard and floppy disk drives,
especially magnetic screwdrivers. Keep both floppy and hard disks apart if disassembled.
d. Keep water and liquids away from your computer and its components.
Chapter 4 Haredware Setup
4.2 Jumper setting
4.2.1 JP1 Clear CMOS jumper (CMOS)
To reset the CMOS data, you should turn off the computer first, take the JP1 jumper cap off pins 1-2, place onto pins 2-3, and then place back onto pins 1-2 again. Then, turn on your computer, press <Del> key during boot up and enter the BIOS setup program to re-set your preferences.
26
VD133 Pro Series
Chapter 4 Hardware Setup
4.2.2 JP9(Vcore+) CPU core voltage select jumper
This function offers adjustable processor Vcore. When NO jumper caps are used, the motherboard automatically generates the proper Vcore voltage that requested by the CPU. Place the jumper cap over pins 1-2 to increase 5% more voltage to the processor’s Vcore. Place the jumper cap over pins 2-3 to increase 10% more voltage to the processors Vcore.
4.2.3 JP10 VIO select jumper (Vio)
This jumper allows you to select the voltage supplied to the DRAM, chipset, PCI and the CPUs I/O buffer. The default voltage should be used unless processor over­clocking requires a higher voltage.
VD133 Pro Series
27
Chapter 4 Haredware Setup
.tluafedstinognittesesehtevaeluoy
4.2.4 JP13 AC97 Codec Enabled / Disabled jumper (AC97)
This jumper is used to enable / disable the onboard audio CODEC. The onboard audio CODEC must be disabled when using an ISA/PCI audio card or a primary AMR card.
4.2.5 JP70 (VD133 Pro only)
This jumper is used to disable/enable the IDE RAID function.No jumper cap is used to disable IDE RAID.
ehtnitluseryamtubgnikcolc-revonehwplehyamegatlovrehgihagnisU
tahtdednemmocerylgnortssitI.efils'tnenopmocretupmocruoyfogninetrohs
28
VD133 Pro Series
Chapter 4 Hardware Setup
4.3 Install the Processor
.metsysruoynonrutuoyerofebnafaesahcrupneht,esaceht
.yrassecenfi,nafyrailixuanallatsniyamuoY.draobrehtomeht
The motherboard is provides a ZIF Socket 370.
Step1:
Locate the ZIF socket and open it by first pulling the lever of socket upward.
tonsisihtfI.gnitaehrevotneverpottiotdehcattanafaevahdluohsUPCehT
knistaehsrossecorpehtssorcanoitalucricriatneiciffussierehttahteruseB
tneiciffustuohtiW.gnikrowsinafUPCruoytahtgnikcehcylralugeryb
dnarossecorpehthtobegamaddnataehrevodluocrossecorpeht,noitalucric
VD133 Pro Series
29
Chapter 4 Haredware Setup
Step2:
Insert the CPU into the socket. Please keep the lever right angle when inserting CPU.
Step3:
When inserting the CPU please note the correct orientation as shown. The notched corner should point toward the end of the lever.
.nwohssanoitatneiroehtnitifylno
lliwUPCeht,srenrocruofehtfoowtrofniprenrocasahUPCehtesuaceB
30
VD133 Pro Series
Chapter 4 Hardware Setup
Step4:
Push the lever down to close the socket.
Step5:
Attach the heatsink onto the CPU.
VD133 Pro Series
.draobrehtomehtotruccoyamegamadesleronafrossecorp
elytspmalcagnitnuomnehwdraobrehtomehteparcsottonluferaceB
31
Chapter 4 Haredware Setup
Step6:
Push the clip of heatsink downward to hock the ear of socket firmly.
Step7:
Finally, attach the fan cable to the CPU fan header FCPU.
.elbissopebtonyampu-toobeslero
4.4 Install Memory Modules
The motherboard has three Dual Inline Memory Module (DIMM) sockets and supports the maximum memory size up to 512MB. These DIMM sockets only support 3.3V unbuffered SDRAM modules of 16M, 32M, 64M, 128M and 256M. The motherboard also support SPD (Serial Presence Detect) architecture to provide the best choice for performance vs. stability.
.elbaliavaebtonlliwnoitcnufCCEehttub,desuebllits
.seludom
32
elpitlumycneuqerf(elpitluMdnaycneuqerFsuBtcerrocehttesottegroft'noD
rossecorp073tekcoSruoyrof)srossecorpdekcolnunoylnoelbaliavasignittes
yamseludomyromemCCEeht,revewoH.CCEtroppustonseodtespihcehT.1
yromemgnivomerrogniddaretfaderiuqersiputesSOIBroerawdrahoN.2
VD133 Pro Series
Chapter 4 Hardware Setup
4.4.1 Memory Configuration Table
Location Support Module Type
Single-Side Module DM0 Double-Side Module Single-Side Module DM1 Double-Side Module Single-Side Module DM2 Double-Side Module
Total System Memory (Max1.5 GB)
Step 1:Open latches of DIMM socket Step 2:Proofread the RAM module to the
Step 3:Insert the RAM module into the Step 4:Press the latches into the notches DIMM Socket of the RAM module
DIMM Socket
VD133 Pro Series
33
Chapter 4 Haredware Setup
4.5 Install PCI Expansion Cards
.sdracnoisnapxednadraobrehtomehthtobotegamad
This motherboard provides five bus master PCI expansion slots. You can expand the features of the computer by adding some expansion cards. Before you do that, read the documentation for your expansion card carefully and make any necessary hardware settings on it, such as jumpers or switches. Locate a free expansion slot and remove the bracket plate with screw on the slot you intend to use, carefully align the cards connectors, press it firmly and secure the card on the slot with the screw you remove above. After installing the necessary software drivers, you can enjoy the features that expansion card provided.
rogniddauoyerofebylppusrewopehtdeggulpnuevahuoytahterusekaM
esuacyamosodoteruliaF.6tnenopmocrehtorosdracnoisnapxegnivomer
tolsICPaotQRInasngissayllacitamotuaSOIBeht,ngisedsubICPehtnI eht,89swodniWnimetsysruoyfopamQRIehtkcehcoT.tinidracasahtaht auoysevighcihw,nocimetsySasniatnocretupmoCyMninocilenaPlortnoC ehtuoysevigecivederawdrahcificepsanokcilcelbuoD.batreganaMeciveD owtontahterusekaM.sserddadnaQRIehtswohshcihw,batecruoseR
ruoyfI.smelborpecneirepxelliwretupmocruoyroQRIemasehtesusecived
SOIBretnenacuoy,QRIcificepsahtiwdemrofrepebtsumdracnoisnapxe
.egapnoitarugifnoCICP/PnPniQRIcificepsehtngissaotmargorpputes
4.6 Usage of the AMR slot
This motherboard provides a Audio Modem Riser (AMR) slot to support a specially designed audio and/or modem card called an AMR card. Main audio and/or modem processing is done by system processor to provide an upgradeable audio and/or modem solution at an incredibly low cost.
There are two type of AMR card, one defined as primary and another defined as secondary. This motherboard uses the primary channel so that a secondary AMR card can coexist without the need to disable the onboard audio CODEC. The onboard audio CODEC must be disabled when using a primary AMR card.
34
VD133 Pro Series
Chapter 4 Hardware Setup
4.7 Usage of the AGP slot
The Accelerated Graphics Port (AGP) is a high-performance bus, especially for graphic-inten­sive 3D applications. AGP is independent of the PCI bus, and is intended for exclusive use with graphics devices.
The most important feature of AGP is DIME (Direct Memory Execute). DIME needs to allocate some system memory via the OS to access large textures outside the local graphic memory of the card. In order to take advantage of the DIME feature, some software components should be installed or upgraded within your system.
VD133 Pro Series
35
Chapter 4 Haredware Setup
4.8 Connect Devices and Power Supply
.yltnenamrepdraobrehtomeht
4.8.1 Primary / Secondary IDE Connectors (IDE0 / IDE1)
This motherboard provides four independent Ultra ATA/66 IDE channels, which doubles the ATA/33 burst data transfer rate to 66 MB/s and are 100 percent backward compatible with all existing ATA / ATAPI devices. These connectors also support ZIP and LS-120 devices.
The ATA/66 requires a special 40-pin, 80-conductor cable that reduces noise bleed­over and improves signal integrity by providing 40 additional ground lines between each of the standard 40-pin ATA (IDE) signal lines and ground lines. Although a new 40-pin, 80-conductor cable is required for Ultra ATA/66, the chipset pin connector remains the same at 40.
.secivedevalsrofdesu
A legacy ATA (IDE) drive can coexist with an Ultra ATA/66 drive. However, for the Ultra ATA/66 device to attain Ultra DMA 4 mode, an Ultra ATA/66 capable cable is required.
ECALPTONOD,srepmujtoneranoitcessihtnidewohssrotcennocehtllA
egamadlliwuoy,osoduoyfI.MEHTFOSNIPEHTREVOSPACREPMUJ
ehT.erutaeftceteDelbaCehttroppuslliwselbacrotcudnoc-08,nip-04ehT
)dne(kcalbehT.draobmetsysehtotdetcennocebdluohsrotcennoc)dne(eulb ebnacrotcennoc)elddim(yargehT.noitisopretsamehtsanwonksirotcennoc
36
rotcennocehtfo1nipotelbacnobbirehtnosgnikramderehttneirO
VD133 Pro Series
Chapter 4 Hardware Setup
4.8.2 The third/The fourth IDE Connectors (IDE2/ IDE3) (VD133 Pro only)
4.8.3 Floppy Connector (FDC)
This motherboard has one floppy connector to support 360K, 720K, 1.2M, 1.44M, 2. 88M, 3 Mode floppy drives and QIC-80 floppy tape drive. After connecting the single end to the board, connect the two plugs on the other end to the floppy devices.
rotcennocehtfo1nipotelbacnobbirehtnosgnikramderehttneirO
VD133 Pro Series
rotcennocehtfo1nipotelbacnobbirehtnosgnikramderehttneirO
37
4.8.4 Back Panel
4.8.4.1 PS/2 Mouse Connector (Green color)
This connector can be used to support a PS/2 mouse.
4.8.4.2 PS/2 Keyboard Connector (Purple color)
This connector can be used to support a PS/2 keyboard.
4.8.4.3 Universal Serial Bus Connectors
This motherboard has two USB ports, any USB-compatible peripherals and/or hub can be connected into either USB port.
Chapter 4 Haredware Setup
.draobrehtomsihtybdetceted-otuaebnacdraobyek2/SPdnaesuom2/SPehT
nacllitsti,rotcennocesuomehtotnidraobyek2/SPehtgulpuoyfisnaemtahT
38
ffonrutuoytahtdednemmocersitI.asrevecivdnaelbuortynatuohtiwkrow
.esuomro/dnadraobyekgnitcennocsidrognitcennocerofebretupmoceht
VD133 Pro Series
Chapter 4 Hardware Setup
4.8.4.4 Serial port COM1&COM2 Connector (T eal color)
One serial port is ready for a modem or other serial devices. A second serial port is available using a serial port bracket connected from the motherboard to an expansion slot opening.
4.8.4.5 Parallel port Connector (Burgundy color)
This connector is used for printers, or other parallel devices.
4.8.4.6 Joystick/Midi and Audio Port Connector (Gold color)
You may connect joysticks or game pads to this connector for playing games, or connect MIDI devices for playing / editing professional audio. Line Out (Lime color) can be connected to headphones or powered speakers. Line In (Light Blue color) allows audio sources to be recorded by your computer or played through the Line Out connector. Mic (Pink color) al­lows microphones to be connected for inputting voice. network hub.
4.8.5 CPU and System FAN Connectors (FCPU and Fsys)
There are two fan connectors on this motherboard. The J39 (FCPU) is designed to support CPU fan; the J41 (Fsys) is for system fan. Depending on the fan manufacturer, the wiring and plug may be different. In most of the case, the red wire is positive, while the black is ground. Connect the fans plug to the board taking into consideration the polarity of the connector.
The Sense signal is to be used only by a specially designed fan with rotation signal. You may use the hardware monitoring utility to monitor the Rotations per Minute (RPM) of the fan.
1. The CPU will overheat if there is no airflow across the CPU heatsink.
2. Damage may occur to the CPU fan and/or motherboard if these pins
VD133 Pro Series
are incorre c tly used.
39
Chapter 4 Haredware Setup
4.8.6 Front Panel Connector (J43)
This connector is composed of all the headers that may be connected to the front panel of the chassis.
4.8.6.1 Power/Soft-Off Connector (PWR_ON)
The system power is controlled by a momentary button connected to this connector. Pressing the button once will switch the system between ON and OFF. Pushing the button for more than 4 seconds will turn the system off.
4.8.6.2 ACPI LED Connector (ACPI)
This 2-pins connector is for a ACPI power status indicator. The LED status will depend on the connector.
4.8.6.3 IDE LED Connector (ALED)
This 2-pin connector connects to the case-mounted IDE LED, which lights when the IDE devices connected to the primary / secondary IDE connectors are working.
4.8.6.4 Reset Connector (RST)
This 2-pin connector connects to the case-mounted reset button for rebooting your computer without having to turn off the power supply.
4.8.6.5 System Power LED Connector (PLED)
This 3-pin connector connects to the case-mounted system power LED, which lights when the system is powered on.
4.8.6.6 Speaker Connector (SPKR)
This 4-pin connector connects to the case-mounted speaker.
40
VD133 Pro Series
Chapter 4 Hardware Setup
4.8.7 Infrared Connector (IR)
This connector supports an optional wireless transmitting and receiving infrared device when using the appropriate application software.
4.8.8 Wake-On-LAN Connector (WOL)
This connector connects to a plug-in network card, which supports the WOL tech­nology to powers up the system when a wakeup packet or signal is received through the LAN card.
a. You may need to enable the Wake Up by Ring/LAN feature in the
BIOS setup pr ogram.
b. Your system must have a ATX power supply with at least 720mA 5VSB
power.
c. This motherboard only supports the LAN card with a high-active wake
signal.
VD133 Pro Series
41
Chapter 4 Haredware Setup
4.8.8 Internal Moden connector (MODEM)
This connection works in conjunction with your modem card. If you intend to use a modem card (inserted into the PCI slot), please connect the cable from the modem card into the Modem header.
4.8.10SMBUS connector J48 (SMBUS)
This connector provides the connectivity of SMBUS utilization.
42
VD133 Pro Series
Chapter 4 Hardware Setup
4.7.11Internal Audio Connector (CD_IN)
This connect allow you to receive stereo audio input from such sound sources as a CD-ROM, TV tuner or MPEG card.
4.8.12 USB 1
VD133 Pro Series
43
Chapter 4 Haredware Setup
4.8.13 ATX Power Supply Connector
This connector connects to the ATX power supply. The plug from the power supply will only insert in one orientation because of the different hole sizes.
.BSV5Am027tsaeltaylppus
4.8.14Power On Procedures
4.8.14.1 After all connections are made, close the system case over.
4.8.14.2 Be sure that all switches are off.
4.8.14.3 Connect the power cord into the power supply located on the back of your
system case (please refer to the manual of your power supply).
4.8.14.4 Connect the power cord into a power outlet that is equipped with a surge
protector.
4.8.14.5 Many of the power supply support 110V/220V by a switch setting. Switch
your power supply to the correct supply voltage (refer to the power supply’s manual).
4.8.14.6 Turn on your system in the following order:
(1 ) The monitor. (2). The external devices.
,nottubffo-tfos/rewopnahtrehtonoitcnufpurewopehttroppusotredronI
tsumylppusrewopXTAruoy,medoM-nO-ekaW,NAL-nO-ekaWsahcus
44
VD133 Pro Series
Chapter 4 Hardware Setup
(3). The computer system.
The power LED on the front panel of the chassis will light. After few seconds, the system will then run power-on tests. Some additional messages will appear on the screen during the test. If you do not see anything within 30 seconds from the time you turn on the power, the system may have failed a power-on test. Recheck the jumper settings and connections or call your retailer for assistance.
4.8.15Power Off Procedures
4.8.15.1 Exit from all the software applications.
4.8.15.2 Shut down your operating system.
4.8.15.3 Switch off the power button. If you are using Windows 95/98, the power
4.8.15.4 Turn off all the external devices.
4.8.15.5 Turn off your monitor.
supply should turn off automatically after Windows shut down
VD133 Pro Series
45
Chapter 5 BIOS Setup
Chapter 5
BIOS Setup
5.1 Introduction
The motherboard uses AWARD BIOS, which is stored in flash memory and can be upgraded using the appropriate software program. The setup program is for viewing and changing the BIOS setting for a computer. These settings are stored in battery-backed RAM so that it retains all the settings after the power has been turned off.
5.1.1 Upgrade BIOS
The BIOS can be upgraded from a diskette with the Award Flash utility AWDFLASH.EXE. The BIOS image file, and update utility are available from IWILL’s WEB site: www.iwill.net
5.1.2 Enter BIOS setup program
Power-on the system by either pressing the Power-On button, or by using any of the power-on features provided by the motherboard. Then, press the <Del> key after the Power-On Self Test (POST), and before the scanning of IDE devices. Simply look for the message Press DEL to enter SETUP displayed at the bottom of the screen during the boot up process. If the message disappears before youve had a chance to respond, you can restart the system by
Turning off the system power then turn it on again, or Pressing the RESET button on the system case, or Pressing <Ctrl>, <Alt> and <Del> keys simultaneously.
5.1.3 Using BIOS setup program
The following table shows the function keys available for each menu screen.
áUp Move to the previous field
Down Move to the next field
â
Left Move to the field on the left hand side
ß
Right Move to the field on the right hand side
à
<Esc> <PgUp> or <+> Select the previous value for a field
<PgDn> or <-> Select the next value for a field <F1> General Help <F2> Item Help <F5> Previous Values <F6> Fail-Safe Defaults <F7> Optimized Defaults <F10> Save the current value and exit setup program
Quit from setup program without saving changes, or Exit from current menu page and return to main menu page
46
VD133 Pro Series
Chapter 5 BIOS Setup
Generally, the BIOS default settings have been carefully chosen by the system manufacturer to provide the absolute maximum performance and reliability. It is very dangerous to change any setting without full understanding. We strong ly recommend that you
DO NOT update your BIOS if the system works perfectly. DO NOT change any setting unless you fully understand what it means.
If the system does not work smoothly after changing the BIOS settings, follow the procedures described previously, enter the BIOS setup program, then load the origi­nal manufacturer default settings.
If the system is no longer able to boot after changing the settings, the only way to recover it is to clear the data stored in RTC CMOS. T o reset the RTC CMOS data, take the JP1 jumper cap off pins 1-2, place onto pins 2-3, and then place back onto pins 1­2 again. This will return the RTC to the default setting. Then, get into the BIOS setup program , choose Load Fail-Safe Defaults ; Load Optimized Defaults, and select the original manufacturer default settings in your CMOS.
5.2 Main Menu
The main menu allows you to select from several setup pages. Use the arrow keys to select among these pages and press <Enter> key to enter the sub-menu. A brief description of each highlighted selection appears at the bottom of the screen.
VD133 Pro Series
47
Chapter 5 BIOS Setup
5.3 Standard CMOS Features
5.3.1 Date
This field specifies the current date. The date format is <month>, <day>, and <year>.
5.3.2 Time
This field specifies the current time. The time format is <hour>, <minute>, and <second>. The time is calculated based on the 24-hour (military-time) clock.
5.3.3 IDE Primary Master / Primary Slave / Secondary Master / Secondary Slave
Press Enter to enter next page for detail hard drive setting.
5.3.3.1 IDE HDD Auto-Detection
Auto-Detect the HDDs Capacity, and its parameters, ex: Cylinder, Head and Sector.
5.3.3.2 IDE Primary Master / Primary Slave / Secondary Master / Secondary Slave
This field specifies type of drive that corresponds to the drive installed in your system. If you select User, please specify the correct number of Cylinders, Heads, and Sectors. Options Description
Manual Selecting manual lets you set the remaining fields on
Auto (*) BIOS automatically fills in the values for the cylinders,
None Any Disk Drives are attached
5.3.3.3 Capacity Auto Display your disk drive size
this screen. Selects the type of fixed disk.
heads and sectors fields
48
VD133 Pro Series
Chapter 5 BIOS Setup
5.3.3.4 Access MODE
5.3.3.5 Cylinders
5.3.3.6 Heads
5.3.3.7 Precomp
5.3.3.8 Sectors
5.3.4 Drive A / Drive B
This field specifies the traditional type of floppy drives. Options Description
None any floppy drive is connected (*Drive B default) 360K, 5.25 in. A 360K floppy drive is connected
1.2M, 5.25 in. A 1.2M floppy drive is connected 720K, 3.5 in. A 720K floppy drive is connected
1.44M, 3.5 in. A 1.44M floppy drive is connected (*Drive A default)
2.88M, 3.5 in. A 2.88M floppy drive is connected
This field specifies the IDE translation mode. Options Description
NORMAL Specifies traditional CHS addressing mode LARGE Specifies extended CHS translation mode LBA Specifies LBA translation mode AUTO(*) BIOS specifies translation method automatically
Set the number of cylinders for this hard disk.
Set the number of read/write heads
Setting a value of 65535 means no hard disk
Set the number of sectors per track
5.3.5 Floppy 3 Mode Support
3 Mode floppy drive is a type of 3.5-inch drive used by NEC PC98 computers. It supports both 1.2M and 1.44M formats using the same drive. This field specifies which drive supports 3 Mode. When a floppy drive is specified to support 3 Mode, the respective drive setting in Drive A / Drive B field will be invalid.
Options Description
Disabled (*) No 3 Mode drive is connected Drive A A 3 Mode drive is connected as drive A Drive B A 3 Mode drive is connected as drive B Both Both drive A and drive B are 3 Mode drives
VD133 Pro Series
49
Chapter 5 BIOS Setup
5.3.6 Video
This field specifies the type of the graphics adapters used by the primary system monitor.
Options Description
EGA/VGA (*) Specifies EGA or VGA adapter CGA 40 Specifies CGA adapter with 40 column mode CGA 80 Specifies CGA adapter with 80 column mode MONO Specifies Monochrome adapter
5.3.7 Halt On
This field determines how the system reacts to errors once detected. Options Description
All Errors (*) Each time the BIOS detects a non-fatal error, the system will
No Errors The system will stop for any errors that are detected All, But Keyboard The system will stop for any errors except keyboard error All, But Diskette The system will stop for any errors except diskette error All, But Disk/Key The system will stop for any errors except diskette and key
stop and display an error message
board errors
5.3.8 Base Memory
The POST (Power-On Self Test) determines the amount of base (conventional) memory installed in the system. The value of the base memory is typically 640K. This field has no options.
5.3.9 Extended Memory
The BIOS determines how much extended memory is present during the POST. This is the amount of memory located above 1MB in the processors memory address map. This field has no options.
5.3.10Total Memory
Displays the total memory available in the system
50
VD133 Pro Series
Chapter 5 BIOS Setup
5.4 Advanced BIOS Features
5.4.1 Virus Warning
When this function is enabled, the BIOS monitor the boot sector and partition table of the hard disk drive for any attempt at modification. If an attempt is made, the BIOS will halt the system and then display an error message. Afterwards, if necessary, you can run an anti-virus program to locate and remove the problem before any damage is done.
Many disk diagnostic programs will attempt to access the boot sector table, which can cause the above warning message. If you run such a program, we recommend that you first disable the Virus Warning function beforehand.
Options Enabled
Disabled (*)
.etairporpparevenehw,gnittestluafedehtsetoned)*(ksiretsanA
5.4.2 CPU Internal Cache
This field configures the CPU internal cache (L1 cache). Options Enabled (*)
VD133 Pro Series
Disabled
51
Chapter 5 BIOS Setup
5.4.3 External Cache
This field configures the systems external cache (L2 cache). Options Enabled (*)
Disabled
5.4.4 CPU L2 Cache ECC Checking
This field specifies whether the CPU L2 cache supports ECC or not. Options Enabled
Disabled (*)
5.4.5 Processor Number Feature
Intel® Pentium® III processors are equipped with a built-in processor serial number for security purposes. When enabled, you allow reading access to this serial number.
Options Enabled
Disabled (*)
5.4.6 Quick Power On Self Test
This field allows the system to skip certain tests while booting. This will decrease the time needed to boot the system.
Options Enabled (*)
Disabled
5.4.7 First / Secondary / Third / Other Boot Device
The BIOS attempts to load the operating system from the devices in the sequence selected in these items.
Options Floppy (*)
LS/ZIP HDD-0 (**) SCSI CD-ROM HDD-1 HDD-2 HDD-3 LAN
RAID66) (***) (VD133 Pro only) Disable
52
VD133 Pro Series
Chapter 5 BIOS Setup
5.5.8 Boot Other Device
Select your boot device priority. Options Enabled (*)
Disabled
5.4.9 Swap Floppy Drive
When enabled, floppy drives A and B will be exchanged without the user physically changing the connection on the cable.
Options Enabled
Disabled (*)
5.4.10Boot Up Floppy Seek
Seeks disk drives during boot up. Disabling speeds boot up. Options Enabled (*)
Disabled
5.4.11Boot Up NumLock Status
This field determines the configuration of the numeric keypad after system boot up. If On, the keypad uses numbers keys. If Off, the keypad uses arrow keys.
Options Description
On (*) Keypad works as number keys Off Keypad works as arrow keys
.draobrehtomsihtno863TPHmorfnoitcnufelbatoobasierehT
5.4.12Gate A20 Option
This field configures how the gate A20 is handled. The gate A20 is a device used to address memory above 1 MB. At first, the gate A20 was handled from a pin on the keyboard. While some keyboards still provide this support, it is more common, and much faster, for modern system chipsets to provide support for gate A20. Options Description
Fast support by core logic Normal(*) Disable
VD133 Pro Series
53
Chapter 5 BIOS Setup
5.4.13Typematic Rate Setting
This field determines if the typematic rate is to be used. When enabled, the BIOS will report (after a moment) that the key has been depressed repeatedly. When disabled, the BIOS will report only once if a key is held down continuously. This feature is used to accelerate cursor movements using the arrow keys.
Options Enabled
Disabled (*)
5.4.14Typematic Rate (Chars/Sec)
When Typematic Rate Setting enabled, this field specifies how many characters will be displayed in one second when a key is held down continuously.
Options 6 (*), 8, 10, 12, 15, 20, 24, 30
5.4.15Typematic Delay (Msec)
When enabled, typematic delay allows you to select the time delay between when the key is first pressed and when the acceleration begins.
Options 250 msec (*), 500 msec, 750 msec, 1000 msec
5.4.16Security Option
This field configures how the system security is handled. It works conjunction with SETTING SUPER VISOR / USER P ASSWORD page to control the security level of the system.
Options Description
Setup (*) System needs a password to enter BIOS setup program System System needs a password to boot
5.4.17OS Select for DRAM >64MB
When enabled, this field allows you to access the memory that is over 64MB under OS/2.
Options OS/2
Non-OS/2 (*)
5.4.18Report No FDD For WIN 95
For a floppy diskless system that runs Windows 95, this field should be set to Yes. Options Yes
No (*)
54
VD133 Pro Series
Chapter 5 BIOS Setup
5.4.19Video BIOS Shadow
When enabled, the video BIOS will be copied to system memory and increase the video speed.
Options Enabled (*)
Disabled
5.4.20C8000-CBFFF / CC000-CFFFF / D0000-D3FFF Shadow D4000-D7FFF / D8000-DBFFF / DC000-DFFFF Shadow
When enabled, the extended ROM data located at the respective address range will be copied to system memory.
Options Enabled
Disabled (*)
5.5 Advanced Chipset Features
This setup page is used to specify advanced features available through the chipset. The default settings have been chosen carefully for most operating conditions. DO NOT change the value of any field in this setup page without full understanding.
DRAM Settings
VD133 Pro Series
The first chipset settings deal with CPU access to dynamic random access memory (DRAM). The default timings have been carefully chosen and should only be altered if data is being lost. Such a scenario might well occur if your system had mixed speed DRAM chips installed. Longer delays might result, however this preserves the integrity of the data held in the slower memory chips.
55
Chapter 5 BIOS Setup
5.5.1 Bank 0/1 2/3 4/5 DRAM Timing
This item allows you to select the value in this field, depending on whether the board has paged DRAMs or EDO (extended data output) DRAMs.
Some engineering knowledge is needed prior to handling Auto Configuration. Options SDRAM 10ns (*) / SDRAM 8ns / Normal / Medium / Fast / T urbo
5.5.2 SDRAM Cycle Length
When synchronous DRAM is installed, the number of clock cycles of CAS latency depends on the DRAM timing. Do not reset this field from the default value specified
by the system designer. Options Description
2 2 system clocks 3 (*) 3 system clocks
5.5.3 DRAM Clock
This field allows you to select the DRAM operating frequency to get better performance. Options Description
Host Clk (*) DRAM clock is the same speed as Front Side Bus
(66/100/133 MHz)
HCLK –33 MHz DRAM clock is set 33 MHz less than the Front Side Bus HCLK +33 MHz DRAM clock is set 33 MHz greater than the Front Side Bus
5.5.4 DRAM Parity / ECC Check
When enabled, the BIOS will use ECC (Error Checking and Correcting) protocol to increase integrity of system data. All memory modules used in the system need to support ECC in order for this function to work properly.
Options Enabled
Disabled (*)
5.5.5 Memory Hole
In order to improve performance, certain space in memory is reserved for ISA cards. This memory must be mapped into the memory space below 16MB.
Note: This field is for experienced users only. Options 15M-16M
Disabled (*)
56
VD133 Pro Series
Chapter 5 BIOS Setup
5.5.6 P2C/C2P Concurrency
When disabled, P2C/C2P will be occupied during the entire P2C/C2P operation period. Options Enabled
5.5.7 CPU to PCI Write Buffer
When this field is enabled, CPU data is written to a write buffer prior to being sent to the PCI bus, in order to compensate for the speed differences between the CPU and the PCI bus. When disabled, the CPU data is sent directly to the PCI bus, however, because the CPU operates at a faster speed than the PCI bus, the CPU must wait as the PCI bus receives data before beginning each write cycle.
Options Enabled (*)
5.5.8 PCI Dynamic Bursting
When enabled, every write transaction goes to the write buffer, and burstable transactions will then burst on the PCI bus, and non-burstable transactions won’t burst on the PCI bus.
When disabled, if the write transaction is a burst transaction, the information goes into the write buffer and burst transfers are later performed on the PCI bus. If the transaction is not a burst transaction, PCI write occurs immediately (after a write buffer flush).
Options Enabled (*)
Disabled
Disabled (*)
Disabled
5.5.9 Delay Transaction
The chipset has embedded 32-bit posted writer buffer to support delayed transaction cycles. When enable, the system is compliant with PCI specificationversion 2.1
Options Enabled (*)
5.5.10System BIOS cacheable
When enable accesses to the system BIOS will be cached Option Enable(*)
VD133 Pro Series
Disabled
Disable
57
Chapter 5 BIOS Setup
5.5.11Video RAM Cacheable
When enabled, access to the video memory located at A0000H to BFFFFH will be cached.
Options Enabled (*)
Disabled
5.5.12AGP Aperture Size (MB)
This field specifies the size of system memory that can be used for AGP graphics aperture.
Options 4M / 8M / 16M / 32M / 64M (*) / 128M
5.5.13AGP-4X Mode
This item allows you to enable / disable the AGP-4X (Clock 266MHz) Mode. Options Enabled (*)
Disabled
5.5.14AGP Fast Write
This item will enable/disable the AGP model.
Option Enabled
Disabled(*)
5.5.15OnChip USB Port 0
This should be enabled if your system have USB port 0 external on the system board and you wish to use it. Even when so equipped, if you add a higher performance controller, you will need to disable this feature.
Options Enabled
Disabled (*)
5.5.16OnChip USB Port1
This should be enabled if your system have USB port 1 internal on the system board and you wish to use it. Even when so equipped, if you add a higher performance controller, you will need to disable this feature.
Options Enabled
Disabled (*)
58
VD133 Pro Series
Chapter 5 BIOS Setup
5.5.17USB Keyboard Under DOS
Select Enabled if your system contains a Universal Serial Bus (USB) controller and you have a USB keyboard under DOS
Options Enabled
Disabled (*)
5.6 Integrated Peripherals
5.6.1 On-Chip IDE Channel 10
This field enables or disables the onboard IDE controller. Options Enabled (*)
Disabled
5.6.2 On-Chip IDE Channel 11
This field enables or disables the onboard IDE controller. Options Enabled (*)
Disabled
5.6.3 Primary Master/Slave PIO
These fields configure the PIO (Programmable Input Output) transfer mode for IDE controller. The maximum transfer rates of each PIO mode are listing as follo
VD133 Pro Series
59
Chapter 5 BIOS Setup
Options Description
Auto (*) The BIOS negotiates with device automatically Mode 0 Use Mode 0 timing to access device Mode 1 Use Mode 1 timing to access device Mode 2 Use Mode 2 timing to access device Mode 3 Use Mode 3 timing to access device Mode 4 Use Mode 4 timing to access device
5.6.4 Secondary Master/Slave PIO
These fields configure the PIO (Programmable Input Output) transfer mode for IDE controller. The maximum transfer rates of each PIO mode are listing as follow:
Options Description
Auto (*) The BIOS negotiates with device automatically Mode 0 Use Mode 0 timing to access device Mode 1 Use Mode 1 timing to access device Mode 2 Use Mode 2 timing to access device Mode 3 Use Mode 3 timing to access device Mode 4 Use Mode 4 timing to access device
5.6.5 Secondary Master / Slave UDMA
If you select Auto, the IDE controller uses Ultra DMA 33/66 Mode to access Ultra DMA-capable IDE devices.
Options Auto (*)
Disabled
5.6.6 Init Display First
This item allows you to decide which slot to activate first, either PCI slot or AGP slot. This function takes place during the system boot.
Options PCI Slot
AGP (*)
5.6.7 AC97 Audio
This item allows you to decide to enable/disable theVIA chipset family to support AC97 Audio.
Options Auto
press Enter
60
VD133 Pro Series
Chapter 5 BIOS Setup
5.6.7.1 Onboard Sound blaster
Options Enabled (*)
5.6.7.2 SB I/O Address Use
5.6.7.3 SB IRQ Use Select
5.6.7.4 SB DMA Use Select
5.6.7.5 MIDI Port
Options Enabled
5.6.7.6 MIDI Address Port
This item allows you to decide onboard legacy sound blaster compatible device.
Disabled
This item allows you to select sound blaster I/O address. Options 220H(*)/240H/260H/280H
This item allows you to select sound blaster IRQ. Options IRQ5(*) / 7 / 9 / 10
This item allows you to selec sound blaster DMA channel. Options DMA 0 / 1(*)/ 2 / 3
This item allows you to selec MIDI Port enable/disable.
Disabled(*)
This item allows you to selec MIDI Port I/O address. Options 330-303H / 310-313H / 320-323H / 330-333H(*)
5.6.8 AC97 Modem
VD133 Pro Series
5.6.7.7 Game port Address
This item allows you to select game port enable/disable. Option Disable
200-207H(*)
This item allows you to decide to enable/disable the VIA chipset family to support AC97 Modem.
Options Auto(*)
Disable
61
Chapter 5 BIOS Setup
5.6.9 IDE HDD Block Mode
When enabled, the IDE controller will use the faster block mode to access devices. Options Enabled (*)
Disabled
5.6.10Onboard FDC Controller
This field enables or disables the onboard floppy controller. Select enabled if you intend to use your floppy disk drive.
Options Enabled (*)
Disabled
5.6.11Onboard Serial Port 1 / 2
These fields configure the onboard serial ports. There are several port addresses and IRQ channels to select from.
Options Description
3F8 / IRQ 4(*) Port address 3F8h, IRQ 4 2F8 / IRQ 3(*) Port address 2F8h, IRQ 3 3E8 / IRQ 4 Port address 3E8h, IRQ 4 2E8 / IRQ 3 Port address 2E8h, IRQ 3 Auto BIOS assigns port address and IRQ channel automatically Disabled Disables serial port
5.6.12COM2 Mode Select
A second serial port is using a serial port bracket connected from the motherboard to an expansion slot opening.
Options Standard(*),HPSIR, ASKIR
5.6.12.1 RxD, TxD Active for HPSIR and ASKIR functions
When setting the field to either IrDA or ASKIR, you must select the active level of receiving and transmission signal. Options Hi, Lo (*) / Lo, Hi / Lo, Lo / Hi, Hi
5.6.12.2 IR Duplex Mode
When setting the field to either HPSIR or ASKIR, you must select the mode of receiving and transmitting signals. Options Half (*) / Full
62
VD133 Pro Series
Chapter 5 BIOS Setup
5.8.13 Onboard Parallel Port
This field configures the single onboard parallel port (LPT). There are several port addresses and IRQ channels to select from.
Options Description
378 / IRQ 7(*) Port address 378h, IRQ 7 278 / IRQ 5 Port address 278h, IRQ 5 3BC / IRQ 7 Port address 3BCh, IRQ 7 Disabled Disables parallel port
5.6.14 Parallel Port Mode
This field configures the operating mode of an onboard parallel port. Ensure you know the specifications of your parallel port devices before selecting field.
Options SPP (*) / EPP / ECP / ECP+EPP
5.6.14.1 ECP Mode Use DMA
When the Parallel Port Mode field is configured as ECP, it needs a DMA channel for data transfer. This field specifies the DMA channel for ECP parallel port use. DMA Options Description
1 Use DMA channel 1 3 (*) Use DMA channel 3
5.6.14.2 EPP Mode Select
When the Parallel Port Mode field is configured as EPP, mode, the EPP version needs to be specified. Please check the EPP specifications before selecting field. EPP Options Description
EPP1.7 Use EPP 1.7 protocol EPP1.9 (*) Use EPP 1.9 protocol
VD133 Pro Series
5.6.14.3 ECP+ EPP Mode Select
When the Parallel Port Mode field is configured as ECP+EPP mode, both the DMA channel and the EPP version need to be specified. Please check the specifications before selecting field. DMA Options Description
1 Use DMA channel 1 3 (*) Use DMA channel 3
EPP Options Description
EPP1.7 Use EPP 1.7 protocol EPP1.9 (*) Use EPP 1.9 protocol
63
Chapter 5 BIOS Setup
5.7 Power Management Setup
Each power-saving mode has a respective timer. The value of the timer can be assigned or reloaded and it will count down to zero. When the timer equals to zero, the system will be forced into the related suspend or power-saving mode. If any predefined signal or event is detected during the timer counting period, the timer restarts automatically.
5.7.1 Power Management
This feature allows the user to select the default parameters for the power-saving mode.
Options Description
Min saving When idle for one hour, the system enters suspend mode Max Saving When idle for fifteen minutes, the system enters suspend mode User Define (*) User can specify the time the system enters suspend mode
5.7.1.1 APM HDD Power Down Timer
This field specifies the time the system enters HDD power down. It is available only when the Power Management field is set to User Define. Options 1 Min / 2 Min / 3 Min / 4 Min / 5 Min / 6 Min / 7 Min /
8 Min / 9 Min / 10 Min / 11Min / 12 Min / 13Min / 14Min / 15Min/ Disable(*)
5.7.1.2 APM Doze Timer Mode
This field specifies the timer value of Doze Mode. It is available only when the Power Management field set to User Define. Options 1 Min / 2 Min / 4 Min /6 Min / 8 Min /10 Min/ 20 Min
30 Min / 1 Hour / Disable (*)
64
VD133 Pro Series
Chapter 5 BIOS Setup
5.7.1.3 APM Suspend Timer
5.7.2 ACPI Suspend Type
There are several ACPI modes used to save computers energy S1 (POS)(*) This is the Power-On-State, the CPU clock runs at slower speed, the
S3 (STR) This is the Suspend-To-Ram State, all system data will be saved in
5.7.3 PM Control by APM
When enabled, an Advanced Power Management (APM) protocol will be activated to handle the power-saving mode.
Options Y es (*)
5.7.4 Video off Option
This field specifies the method that video subsystem used for power saving. Options Descriptio
Always ON Monitor will remain on during power saving modes Suspend Off Monitor blanked when the systems enters the Suspend modes All Modes Off Monitor blanked when the system enters any power saving
5.7.5 Video off Method
This field specifies the method that video subsystem used for power saving. Options Description
V/H SYNC+Blank Turn off the vertical and horizontal synchronization ports
Blank Screen Writes blanks to the video buffer only DPMS (*) Initial display power management signaling with DPMS
This field specifies the time the system enters power-saving mode. It is available only when the Power Management field is set to User Define. Options 1 Min / 2 Min / 4 Min /6 Min / 8 Min / 10 Min / 20 Min
30 Min / 40 Min / 1 Hour / Disable (*)
system operates at slower speed
systems memory and all devices except the memory will shut off
.edom3Sehttroppusnac,dracAGVruoygnikcehcesaelP
No
mode.
and write blanks to the video buffer
VD133 Pro Series
65
Chapter 5 BIOS Setup
5.7.6 MODEM Use IRQ
This determines the IRQ in which the Modem can use. options 3(*)/4/5/7/9/10/11/NA
5.7.7 PWR-OFF Mode by PWR-BTTN
This field specifies the function of power button.
Options Description
Instant-Off (*) When power button is pressed, the system turns off immediately. Delay 4 Sec. After the power button has been pressed and held for four
seconds, the system turns off.
5.7.8 AC PWR Loss Recovery
The field configures the system status after experiencing a power failure. Options Description
Former-Sts System returns to former status prior to power failure (on or off ) Off (*) System remains off after power lost
5.7.9 Wake Up Events
These are I/O events whose occurrence can prevent the system from entering a power-saving mode, or can awaken the system from such a mode. In effect, the system remains alert for anything that occurs to a device configured and recognized by the system, even when the system is in a power down mode.
5.7.9.1 VG A
When ON, your can set the VGA to awaken the system. Options OFF (*)
5.7.9.2 LPT & COM
When On, any activity from one of the listed system peripheral devices or IRQs wakes up the system.
Options None
5.7.9.3 HDD & FDD
When On, any activity from either hard disk drive or floppy disk drive wakes up the system. Options OFF
ON
LPT COM LPT/COM (*)
ON (*)
66
VD133 Pro Series
Chapter 5 BIOS Setup
5.7.9.4 PCI master
When On, the system can be resumed from power saving mode by any PCI / master activity signal.
Options OFF (*)
5.7.9.5 Wake up by PCI card
When enabled, you can wake-up your system using a PCI rev.2.2 card, such as a WOL card, connected in your PCI slot.
Options Enabled
5.7.9.6 Wake Up by Ring/LAN
When enabled, the PC can power-on through an external modem connected to your PC. For example, you may send an e-mail message to your PC from another location, and this will power-on your PC. When using this feature, you must have a modem, and your PC must be turned off. Note: This feature alone doesn’t allow you to power off your PC (see 4.6. 9 Suspend Mode).
Options Enabled
5.7.9.7 PWROn/Resume by Alarm
When enabled, you can set the date and time to automatically power-on your PC (similar to an alarm clock). The alarm from RTC (real-time clock) automatically turns on the system.
Options Description
Disabled (*) Disables RTC alarm function Enabled Sets Date (0-31) and Timer (hr, min, sec) to power-on the
5.7.9.8 IRQs Activity Monitoring
When On, any event that occurs will awaken the system after it has powered­down.The following is a list of IRQs, or Interrupt Requests, which can be exempted much as the COM ports and LPT ports above can. When an I/O device wants to gain the attention of the operating system, it signals this by causing an IRQ to occur. When the operating system is ready to respond to the request, it interrupts itself and performs the service.
ON
Disabled (*)
Disabled (*)
PC. When date is set to 0, the Timer is set for every day.
VD133 Pro Series
67
IRQ Options
IRQ3 (COM 2) Disable/Enable(*) IRQ4 (COM 1) Disable/Enable(*) IRQ5 (LPT 2) Disable/Enable(*) IRQ6 (Floppy Disk) Disable/Enable(*) IRQ7 (LPT 1) Disable/Enable(*) IRQ8 (RTC Alarm) Disable(*)/Enable IRQ9 (IRQ2 Redir) Disable(*)/Enable IRQ10 (Reserved) Disable(*)/Enable IRQ11 (Reserved) Disable(*)/Enable IRQ12 (PS / 2 Mouse) Disable/Enable(*) IRQ13 (Coprocessor) Disable/Enable(*) IRQ14 (Hard Disk) Disable/Enable IRQ15 (Reserved) Disable(*)/Enable
5.8 PnP/ PCI Configurations
Chapter 5 BIOS Setup
5.8.1 PNP OS Installed
The field specifies whether a Plug and Play operating system is installed. Options Yes
No (*)
5.8.2 Reset Configuration Data
Normally, you leave this field Disabled. Select Enabled to reset Extended System Configuration Data (ESCD) when you exit Setup if you have installed a new add-on and the system reconfiguration has caused such a serious conflict that the operating system can not boot.
Options Enabled
Disabled (*)
68
VD133 Pro Series
Chapter 5 BIOS Setup
5.8.3 Resources Controlled By
The A ward Plug and Play BIOS has the capacity to automatically configure all of the boot and Plug and Play compatible devices. However, this capability means abso­lutely nothing unless you are using a Plug and Play operating system such as WindowsÒ98/95/NT. If you set this field to “manual” choose specific resources by going into each of the sub menu that follows this field (a sub menu is preceded by a “Ø”).
Options Description
Auto (ESCD)(*) Resources controlled by BIOS automatically Manual Resources controlled by the user
5.8.3.1 IRQ Resources
When resources are controlled manually, assign each system interrupt a type, depending on the type of device using the interrupt.
5.8 .3 . 1. 1 IRQ3/4/5/7/9/10/11/12/14/15 assigned to
5.8.4 PCI / VGA Palette Snoop
This item allows you to determine the IRQ assigned to the ISA bus and is not available to any PCI slot. Legacy ISA for devices compliant with the original PC AT bus specification, PCI/ISA PnP for devices compliant with the Plug and Play standard whether designed for PCI or ISA bus architecture.
Options PCI Device
Reserved
This field controls the ability of a primary PCI graphics controller to share a common palette with an ISA/VESA video or MPEG card
Options Description
Enabled PCI VGA co-works with ISA MPEG card Disabled (*) All cases except above
5.8.5 PCI 1/ On board RAID IRQ Use (On board RAIID VD133 Pro only)
This field determines the IRQ setting for PCI1. PC1 and PC2 may share the same IRQ, or other options may be selected. The default setting for this field is Auto, which uses automatic-routing to determine the setting.
Options Auto (*) / 3 / 4 / 5 / 7 / 9 / 10 / 11 / 12 / 14 / 15
5.8.6 PCI 2 IRQ Use
This field determines the IRQ setting forPCI2. The default setting for this field is Auto, which uses automatic-routing to determine the setting.
Options Auto (*) / 3 / 4 / 5 / 7 / 9 / 10 / 11 / 12 / 14 / 15
VD133 Pro Series
69
Chapter 5 BIOS Setup
5.8.7 PCI 3 IRQ Use
This field determines the IRQ setting for PCI3. The default setting for this field is Auto, which uses automatic-routing to determine the setting.
Options Auto (*) / 3 / 4 / 5 / 7 / 9 / 10 / 11 / 12 / 14 / 15
5.8.8 PCI 4 IRQ Use
This field determines the IRQ setting for PCI4. The default setting for this field is Auto, which uses automatic-routing to determine the setting.
Options Auto (*) / 3 / 4 / 5 / 7 / 9 / 10 / 11 / 12 / 14 / 15
5.9 PC Health Status
This page is monitoring your status of computer. On the screen displays CPU/System temperature, FAN speed, and voltages.
70
VD133 Pro Series
Chapter 5 BIOS Setup
5.10 IWILL Smart Setting
Over-clocking is not guaranteed. Users must have substantial knowledge of proper CPU relative to adjusting CPU speeds. Over -clocking should be done only by experienced engineers who conduct tests.
5.10.1Auto Detect DIMM/PCI Clk
When enabled, the motherboard will automatically disable the clock source for a DIMM socket, which does not have a module on it. This is true for all PCI slots.
Options Enabled (*)
5.10.2Spread Spectrum
This item configures radiation emitted from the system. When enabled, system will release less radiation.
Options Enabled
Over-clocking sometimes makes computer not work properly. You would close the system and power and p lay insert the key on the keyboard. Waiting to see the monitor frame and set ”inse rt” key.
VD133 Pro Series
Disabled
Disabled (*)
71
Chapter 5 BIOS Setup
5.10.3CPU / PCI Clock
This field allows user to adjust the CPU external frequency. Options BY JUMPER
66/33MHz , 68/34MHz , 75/37MHz , 80/40MHz , 83/41MHz , 90/30MHz 95/31MHz , 100/133MHz , 103/34MHz ,105/35MHz , 110/36MHz , 112/37MHz ,115/38MHz , 124/31MHz , 130/32MHz , 133/33MHz , 135/34MHz ,138/34MHz ,140/35MHz , 144/36MHz , 150/37MHz , 155/38MHz , 160/40MHz , 166/41MHz
5.10.4PU Clock Ratio:
Option 3/3.5/4/4.5/5/5.5/6/6.5/7/7.5/8
5.11 Load Fail-Safe Defaults
When you press <Enter> on this item you get a confirmation dialog box with a message similar to:
Pressing Y loads the BIOS default values for the most stable, minimal-performance system operations.
on this item you get a confirmation dialog box with a message similar to:
72
VD133 Pro Series
Chapter 5 BIOS Setup
5.12 Load Optimized Defaults
When you press <Enter> on this item you get a confirmation dialog box with a message similar to:
Pressing Y loads the default values that are factory settings for optimal performance system operations.
5.13 Set Supervisor / User Password Setting
These setup pages are used for password setting. When a password has been enabled and the Security Option field is set as Setup, you will be required to enter the password every time you try to enter BIOS Setup program. This prevents an unauthorized person from changing any part of your system configuration. Additionally, if the Security Option field is set as Boot, the BIOS will request a password every time your system boot. This would prevent unauthorized use of your computer.
In you wish to use this function, bring the cursor to this field, then press <Enter>. The computer will display the message, Enter Password. T ype your password and press <Enter>. After the message onfirm Password is displayed, re-type your password. The Supervisor Password function will be in effect after you save and exit setup.
To disable a password, bring the cursor to this field, then press <Enter>. The computer will display the message, Enter Password. Press <Enter>. A message will confirm that the password is disabled. Once the password is disabled, the system will boot and you can enter setup program freely.
VD133 Pro Series
73
Chapter 5 BIOS Setup
5.14 Save & Exit Setup
Saves current CMOS value and exit BIOS setup program.
5.15 Exit Without Saving
Abandons all CMOS value changes and exits BIOS setup program.
.ecalpefasnidrowssapruoypeekecalP.sdleifynafoeulaveht
egnahctonnacuoytub,margorpputesSOIBretneotuoyswolladrowssaPresUehT
74
VD133 Pro Series
Chapter 5 BIOS Setup
VD133 Pro Series
75
Chapter 6 Power Installer CD
Chapter 6
Power Installer CD
6.1 Software Installation
The attached Power Installer CD contains all the necessary drivers, utilities for IWILL’s full range of motherboards. It provides an easy way for users to install the needed drivers without going through a complicated process. The Power Installer CD is able to auto-detect and display the drivers, utilities needed for your motherboard.
6.1.1 Whats inside Power Installer CD for this motherboard
1. Drivers
Service Pack Driver Sofware Audio Driver Iwill SIDE RAID 66 Install Guide (VD133 Pro only)
2. Utilities
Make Driver Diskettes Anti-Virus Hardware Monitor Utility(Window9X only) STD guide Acrobat Reader High Point Xstore Pro(Window9X only)(VD133 Pro only)
Iwill SIDE RAID 66 Install Utility (VD133 Pro only)
3. Manuals
6.2 How to use the Power installer CD
The Power Installer CD supports the Auto Run program under Windows 98/95 and Windows NT operating systems. All the necessary drivers, utilities and manual for this motherboard will show on the screen. Select the one that needs to be installed, then simply follow the messages displayed on the screen to complete setup.
.tillatsniotesuoma
76
esutsumuoY.tnemomsihttadraobyekatroppustonseodrellatsnIrewoPLLIWI
VD133 Pro Series
Chapter 6 Power Installer CD
6.2.1 How to view manual
This Power Installer CD includes detailed information of all IWILL manuals for every motherboard manufactured by IWILL. Please insert the IWILL Power Installer CD into the CD-ROM drive; Click the View Manual item, and select the product that you want to view.
6.2.2 How to make driver diskette
6.2.2.1 Without O.S. installed
This bootable Power Installer CD also allows you to boot up your system, even when the OS has not been installed. During the boot-up process, you can perform IWILL Diskette Creator, which will automatically make the driver diskettes you need.
Follow the instructions below to make your own device driver floppy diskettes if you have a CD-ROM with IDE interface. If you have already installed SCSI CD-ROM, please make sure your SCSI host adapter sup­ports bootable CD-ROM, and then proceed directly to step 8 , and then finish the procedure.
1. First, power-on or boot your system.
2. Press <Del> key during boot sequence to enter CMOS Setup Utility
3. Use arrow keys to select ADV ANCED BIOS FEA TURES on the menu, then press Enter.
4. Select First Boot Device and change the default setting from Floppy to CDROM using Page Up /Page Down key.
5. Press <Esc> key to go back to CMOS SETUP Utility menu.
6. Press <F10> to select Save and Exit Setup
7. Press Y then Enter to complete. Now you are able to boot up the system from the CD-ROM.
8. Insert the Power Installer CD into the CD-ROM drive and re-start the computer.
9. IWILL Diskette Creator will now execute automatically for making your own driver diskettes.
10. Make the desired driver diskettes according to the instructions displayed on screen.
6.2.2.2 Under windows 98/95/NT
Y ou may just click on the software Make Driver Diskettes Utility shown on screen, then select the driver you need, follow the messages shown on screen to complete.
.ylreporpkrow""rotaerCetteksiDLLIWI""
ekamotyrasseceneraevirdyppolfM44.1enodnaevirdMOR-DCenotsaeltA
VD133 Pro Series
77
Chapter 6 Power Installer CD
6.2.4 How to install VIA Service Pack(4 in 1. EX: Bus Master, ACPI, IRQ, AGP)
Simply click on the software shown on screen that needs to be installed, then simply follow the messages displayed on the screen to complete setup.
Simply click on the software shown on screen that needs to be installed, then simply follow the messages displayed on the screen to complete setup.
6.2.4 How to install Security Driver
Y ou may just click on the Security Driver shown on screen that needs to be installed, then follow the prompts to complete setup.
6.2.5 How to install Software Audio Driver
Y ou may just click on the Software Audio Driver shown on screen that needs to be installed, then follow the prompts to complete setup.
6.2.6 How to install Iwill SIDE RAID 66 Utility (VD133 Pro only)
Y ou may just click on the Iwill SIDE RAID 66 Installation Utility shown on screen . Please follow the istructions to install the network driver.
6.2.7 How to use PC-Cillin Anti-Virus program
Simply click on the PC-Cillin Anti-Virus shown on screen that be installed, then follow the prompts to complete setup.
6.2.8 How to use Hardware Monitoring Utility(Window 9X only)
Y ou may just click on the Hardware Monitor Utility shown on screen then follow the prompts to complete setup.
6.2.9 How to install Highpoint Xstore Pro(Window 9X only) (VD133 Pro only)
You may just click on the Highpoint Xstore Pro shown on screen then follow the prompts to complete setup.
78
VD133 Pro Series
Chapter 6 Power Installer CD
6.3 Installing Operating Systems
This section briefly demonstrates how to install a few popular software operating systems. Use this section only as a guide. It is highly recommended that users first refer to the installa­tion manual of their operating system for a more thorough, detailed description on how to install the operating system.
6.3.1 Windows 98
Whenever installing Windows 98, please remember that Setup creates a new folder for Windows 98, and wont transfer any existing system settings. Windows 98 will be­come your default operating system, and will use standard system settings. This procedure represents an entirely new installation of Windows, therefore youll need to reinstall any existing programs you may want to use.
There are two ways to install Windows 98. Each method depends on your current computer setup.
.draziwputeS89swodniW
6.3.1.1 Installing the CD-ROM version of Windows 98
1. Place a Windows 98 Startup Disk into the floppy disk drive.
2. Restart your computer. The Microsoft Windows 98 Startup menu will appear .
3. Place the Windows 98 CD into your CD-ROM drive.
4. Type the number 1 and press <ENTER >. A series of scans is performed, and then the MS-DOS prompt is displayed.
5. Type the word setup at the MS-DOS display, and press <ENTER>. Setup performs a check (A message will be displayed). This message wont appear if your computer cant locate your CD­ROM drive. If you havent installed the correct CD-ROM driver, please consult your drives documentation or contact your hard ware manufacturer.
6. Press <ENTER>. Microsoft ScanDisk will check your disk drives for errors.
7. When ScanDisk finishes, press the X key. Setup will initialize. Then, Windows 98 Setup begins.
8. Please follow the instructions that are displayed.
.89swodniWfonoisrevedargpuehtgnisu
ehtgnisusemitlarevestratseryllacitamotualliwretupmocruoy,puteSgniruD
er'uoyfisksid1.3swodniWro59swodniWlanigiroruoytresniotuoyksayamputeS
VD133 Pro Series
79
Chapter 6 Power Installer CD
6.3.2 Windows NT
6.3.2.1 Installing the CD-ROM version of Windows NT on an IDE system
1. First, power-on or boot your system.
2. Press <Del> key during boot sequence to enter CMOS Setup Utility
3. Use arrow keys to select BIOS FEATURES SETUP” on the menu, then press Enter.
4. Select Boot Sequence and change the default setting from A, C, SCSI to CD-ROM, C, A using Page Up /Page Down key.
5. Place the Windows NT 4.0 CD-ROM in the drive.
6. Follow all instructions to finish Windows NT installation.
80
VD133 Pro Series
Loading...