Page 1
+3-RUQDGD6HULHV
3RFNHW3&
8VHUV*XLGH
Printed in Singapore
Edition 1
Page 2
&RS\ULJKW
The information contained in this document is provided “as is” and is subject to
change without notice.
Hewlett-Packard Company makes no warranty of any kind with regard to this
manual, including, but not limited to, the implied warranties of merchantability
and fitness for a particular purpose. Hewlett-Packard Co. shall not be liable for
any errors contained herein or for incidental or consequential damages in
connection with the furnishing, performance, or use of this manual or the
examples herein.
© Hewlett-Packard Co. 2001.
This document contains proprietary information that is protected by copyright.
All rights are reserved. No part of this document may be photocopied,
reproduced, adapted, or translated to another language without the prior
written consent of Hewlett-Packard Co., except as allowed under the copyright
laws.
The programs that control this product are copyrighted and all rights are
reserved. Reproduction, adaptation, or translation of those programs without
prior written permission of Hewlett-Packard Co. is also prohibited.
Microsoft, ActiveSync, Outlook, Pocket Outlook, Expedia, AutoRoute Express,
MapPoint, Windows, Windows NT, the Windows logo, and the Windows CE
logo are either registered trademarks or trademarks of Microsoft Corporation
in the United States and/or other countries. Microsoft products are licensed to
OEMs by Microsoft Licensing, Inc., a wholly owned subsidiary of Microsoft
Corporation.
All other brand names and product names used in this document are trade
names, service marks, trademarks, or registered trademarks of their
respective owners.
+HZOHWW3DFNDUG6LQJDSRUH3WH/WG
$VLD3DFLILF3HUVRQDO&RPSXWHU'LYLVLRQ
$OH[DQGUD5RDG
6LQJDSRUH
Page 3
&RQWHQWV
1 | Welcome ......................................................................................1
What’s in the box ......................................................................2
Using this manual .....................................................................2
What’s on your HP Jornada......................................................4
Where to find information..........................................................7
2 | Getting started.............................................................................. 9
Hardware features ..................................................................10
Using your HP Jornada for the first time.................................12
Turning your HP Jornada on and off.......................................14
Using the hardware buttons and LED.....................................14
Navigating in Windows for Pocket PC ....................................16
Entering information................................................................20
Finding and organizing information.........................................27
3 | Connecting to your desktop PC..................................................29
Installing Microsoft ActiveSync on your desktop PC...............30
Installing the HP Dynamic Voice audio codec.........................31
Connecting your HP Jornada..................................................33
Establishing a partnership.......................................................36
Synchronizing data.................................................................37
Browsing your HP Jornada from your desktop........................39
Transferring files between your HP Jornada
and your desktop PC.........................................................40
Backing up and restoring data................................................40
4 | Connecting to the Internet or to a network..................................45
Connecting your HP Jornada..................................................46
Creating an ISP or network connection ..................................48
Browsing the Web (or a corporate intranet)............................50
Sending and receiving e-mail..................................................55
5 | Configuring your HP Jornada..................................................... 61
Managing power .....................................................................62
Managing memory..................................................................63
Adjusting settings....................................................................64
Security...................................................................................66
Configuring hardware buttons.................................................68
Configuring menus..................................................................70
Adding or removing programs.................................................72
Page 4
6 | Microsoft Pocket Outlook............................................................75
Calendar: scheduling appointments and meetings .................76
Contacts: tracking friends and colleagues ..............................77
Tasks: keeping a to-do list......................................................79
Notes: capturing thoughts and ideas ......................................80
Exchanging appointments, contacts, tasks, and
notes with other devices (HP info exchange)....................81
7 | Companion programs................................................................. 83
Microsoft Pocket Word............................................................84
Microsoft Pocket Excel............................................................85
Microsoft Windows Media Player............................................86
Microsoft Reader ....................................................................89
OmniSolve..............................................................................90
8 | Accessories................................................................................91
HP branded accessories.........................................................92
CompactFlash cards...............................................................93
9 | Troubleshooting.......................................................................... 95
Resetting your HP Jornada.....................................................96
Basic problems.......................................................................98
Remote connections.............................................................101
Display problems..................................................................103
10 | Support and service................................................................105
Web site................................................................................105
Customer support .................................................................105
Service..................................................................................105
Contacting Hewlett-Packard worldwide.................................106
Warranty........................................................................................ 109
Glossary........................................................................................115
Appendix A: Character recognition...............................................119
Appendix B: Migrating data from other devices............................123
Index .............................................................................................127
Page 5
_:HOFRPH
Congratulations on purchasing the Hewlett-Packard Jornada 520 Series
Pocket PC, a Microsoft® Windows®-powered Pocket PC. Your HP Jornada
Pocket PC lets you keep your most important business and personal
information current and close at hand. Your HP Jornada includes the Microsoft
Windows for Pocket PC software, such as the latest version of Microsoft
Pocket Outlook®, so you can read and write e-mail while on the road and
manage your appointments and contacts. You will find that your HP Jornada is
also the perfect companion to your desktop or notebook PC, allowing you to
take vital business data and documents with you and easily upl oad updated
information upon returning to your desk. HP Jornada offers you the highest
quality in performance and power management as well as rich programs and
utilities designed by Hewlett-Packard, making HP Jornada your powerful,
reliable, mobile business partner.
In this chapter, you will find:
a list of the HP Jornada package contents
•
an overview of this User’s Guide, and pointers to other sources of helpful
•
information
descriptions of the programs and features included with your Pocket PC
•
| 1
Page 6
2 | HP Jornada 520 Series User’s Guide
:KDWVLQWKHER[
Your HP Jornada package includes the following items:
HP Jornada Pocket PC, with carrying pouch and stylus
•
ac adapter
•
serial cable for connection to a desktop PC
•
HP Jornada Quick Start Guide—a graphic guide to setting up your HP
•
Jornada
HP Jornada CD-ROM—includes programs and utilities that add
•
functionality to your HP Jornada; this User’s Guide, which provides
detailed information about your HP Jornada hardware and software; and
the HP Jornada Accessories Guide, which provides information about
optional add-ons to your HP Jornada.
HP documentation pack—includes the Regulatory Information Leaflet and
•
the HP Jornada Accessory Guide
Microsoft ActiveSync® CD-ROM and Getting Started with Microsoft
•
ActiveSync booklet
8VLQJWKLVPDQXDO
This User's Guide is designed to help you get started using your HP Jornada
quickly and easily. Although great care has been taken to ensure the accuracy
of procedures and artwork, some of the screens displayed on your HP
Jornada may be different than the ones that appear in this User’s Guide.
Detailed, step-by-step instructions for using the programs on your HP Jornada
are also included in online Help, so you will always have access to them, and
you do not have to carry this guide when you travel. (For more information on
using online Help, see “Using online Help on your HP Jornada” later in this
chapter.)
This User's Guide includes the following chapters:
• Chapter 1, Welcome.
package and this User's Guide.
• Chapter 2, Getting started.
charging your Pocket PC, completing the Welcome Wizard, and preparing
to use your HP Jornada for the first time.
• Chapter 3, Connecting to your desktop PC.
to know to connect your Pocket PC, transfer files, and synchronize
Microsoft Pocket Outlook data and e-mail messages.
Offers a quick overview of the HP Jornada
Provides step-by-step instructions for
Offers everything you need
Page 7
Chapter 1 | Welcome | 3
• Chapter 4, Connecting to the Internet or to a network.
Explains how to
use a CompactFlash card modem* to connect to the Internet through an
Internet service provider, or install a CompactFlash network interface card
to connect to a network. Once you are online, you can browse the Internet
or intranet, and send and receive e-mail directly from your Pocket PC.
• Chapter 5, Configuring your HP Jornada.
Details the many ways you
can add functionality to your HP Jornada by installing additiona l software
and programs, and explains how you can customize your HP Jornad a
using HP settings and control panels.
• Chapter 6, Microsoft Pocket Outlook.
Describes the Contacts,
Calendar, Tasks, and Notes programs (“personal information manager”
programs) included with your HP Jornada.
• Chapter 7, Companion programs.
Describes the productivity programs
included with your HP Jornada, including the Microsoft Windows for
Pocket PC software (Microsoft Pocket Word, Pocket Excel, Microsoft
Reader, and the Windows Media™ Player), and the OmniSolve®
calculator from Landware.
• Chapter 8, Accessories.
Describes the HP accessories available for
your Pocket PC, and includes instructions on how to add functionality
using a CompactFlash card.
• Chapter 9, Troubleshooting.
Explains how to reset your Pocket PC and
how to restore your Pocket PC to the factory default settings, and
provides helpful tips and procedures to follow when things do not work
quite as you expected.
• Chapter 10, Support and service.
Includes phone numbers and
directions to help you obtain technical support from Hewlett-Packard.
This User's Guide includes certain visual cues that will help you find the
information you want easily.
A shortcut, another way to do something, or expanded information
about the topic.
Caution or warning information about the topic. This is important
information that should be observed to prevent loss of data or
damage to your HP Jornada.
Helpful information related to the topic.
* Modem must be purchased separately. Some Web sites/content may not be available.
Page 8
4 | HP Jornada 520 Series User’s Guide
:KDWVRQ\RXU+3-RUQDGD
Your HP Jornada already includes the full suite of software you need to
function as a mobile professional. These programs are introduced below.
Detailed information can be found in later chapters.
The programs listed below are installed in ROM. They cannot be deleted, and
you will never need to reinstall them.
+3SURJUDPV
HP settings.
speaker volume to suit your work environment. Choose from four preset
profiles or create your own.
HP security.
unauthorized users from accessing your HP Jornada.
HP backup.
office by backing up your personal information manager (PIM) databases
(Contacts, Calendar, and Tasks) or your entire Pocket PC to a
CompactFlash card.
HP game buttons.
PC. Use the HP game buttons application to assign game actions to your
Pocket PC hardware buttons.
HP home menu.
used documents. Assign each of the buttons on the HP home menu to a
different document or program.
HP task switcher.
close any program from a pop-up menu on the Today screen.
HP info exchange.
and from non–Windows-powered devices from within Pocket Outlook. Also
receive (but not send) notes and store them as a text file in the My
Documents folder of your HP Jornada.
Adjust the brightness and contrast of the display and set the
Protect your data with a four-digit password that prevents
Protect your valuable data even when you are away from your
Run up the score in your favorite games on your Pocket
Quickly launch your favorite programs or open frequently
Switch between open programs and documents, or
Send and receive contacts, appointments, and tasks to
Page 9
0LFURVRIW:LQGRZVIRU3RFNHW3&VRIWZDUH
Pocket Excel.
Pocket Word.
Tasks.
Microsoft Pocket Internet Explorer.
Microsoft Windows Media Player for Pocket PC.
Microsoft Reader.
Calendar.
Contacts.
Inbox.
Notes.
created on your desktop PC.
created on your desktop PC.
and subscription content.
clips on your Pocket PC. Windows Media Player lets you play songs or files
that have been recorded in MP3, WMA, or WAV format.
Keep track of your appointments and create meeting requests.
Keep track of your friends and colleagues.
Send and receive e-mail messages.
Create handwritten or typed notes, drawings, and recordings.
Create new workbooks, or view and edit Excel workbooks
Create new documents, or view and edit Word documents
Keep track of your tasks.
Browse the Web and view channels
Read electronic books on your HP Jornada.
Chapter 1 | Welcome | 5
Play songs and sound
7KLUGSDUW\VRIWZDUH
OmniSolve.
this full-featured calculator from Landware.
Perform complex mathematical and business calculations with
$GGLWLRQDOSURJUDPV
The CD-ROMs included with your HP Jornada include additional programs
you can install. For installation instructions, see “Adding or removing
programs” in chapter 5.
You can also install programs from a variety of sources, including the Internet.
For more information, see “Adding or removing programs” in chapter 5.
Page 10
6 | HP Jornada 520 Series User’s Guide
Find the following programs on the HP Jornada CD-ROM:
HP Jornada User’s Guide. The User’s Guide provides detailed information
•
about your HP Jornada hardware and software. The User’s Guide is
provided in Portable Document Format (PDF), and requires the Adobe®
Acrobat® Reader, available from the Adobe Web site at www.adobe.com
Yahoo!® Messenger* from Yahoo! Inc. Yahoo! Messenger allows you to
•
.
instantly communicate with all your online friends, and check stock-prices,
news, sports scores, and more.
AudiblePlayer™ 2.0 for Windows CE and AudibleMan ager™ 3.0 from
•
Audible Inc.* Listen to best-selling audiobooks, newspapers, magazines,
and more.
MusicMatch® Jukebox 6.0 from MusicMatch Corporation. MusicMatch
•
Jukebox 6.0, with new Internet Radio, gives music fans the power to play,
record, organize, and discover new music. MusicMatch Jukebox and HP
Jornada Pocket PC—the ultimate personal music system!
EzWAP from EZOS. This browser enables you to browse Internet sites
•
that use wireless access protocol (WAP) to deliver content designed
specifically for mobile devices.
Sample MP3 songs from EMusic.com™.* EMusic.com is the premier site
•
for your MP3 music. Whether you are into rock, jazz, blues, techno, or hip
hop, EMusic.com features thousands of tracks from the artists you are
looking for.
HPC Notes™ 3.05 Lite Edition (full) and Professional Edition (trial) from
•
PhatWare™ Corporation.* HPC Notes 3.05 is a powerful notes creator
and organizer for Windows for Pocket PC. It allows users to create notes,
password-protect them, and organize them by type, subject, and creation
and modification date.
The programs included on the CD-ROMs are subject to change. Check your
CD-ROM for the complete list, and visit the HP Web site at
www.hp.com/jornada/solutions for even more programs and software updates.
Find the following programs on the ActiveSync CD-ROM:
Microsoft Transcriber version 1.1 for Windows CE. Transcriber lets you
•
take down phone numbers, notes, and more as easily and naturally as
writing on a piece of paper. Transcriber recognizes all handwriting,
whether cursive, printed, or a combination of both.
* Available on English language versions only.
Page 11
Chapter 1 | Welcome | 7
Microsoft Money for Pocket PC. Record expenses, balance your
•
checkbook, and track your investments. You can also update Microsoft
Money accounts on your desktop PC with information from your HP
Jornada. (Microsoft Money for Pocket PC can synchronize only with the
US English version of Microsoft Money.)
Microsoft Internet Explorer 5. Browse the Web with the latest version of
•
the Microsoft browser software for your desktop PC.
Microsoft Outlook 2000. Manage your messages, appointments, contacts,
•
and tasks on your desktop PC.
Microsoft Windows Media Manager for Pocket PC. Convert different
•
music and sound files to the proper format and transfer them to your HP
Jornada.
Sample content for use with Microsoft Reader.
•
:KHUHWRILQGLQIRUPDWLRQ
The following table is a guide to additional information to help you use your
HP Jornada.
For information on: See this source:
Programs on your HP Jornada This User’s Guide or online Help on your
device. Tap
view Help for the active program.
Help
on the
Start
menu to
Additional programs that can be
installed on your HP Jornada
Connecting to and
synchronizing with a desktop
PC
Last-minute updates and
detailed technical information
The HP Jornada CD-ROM, the Extras
folder on the ActiveSync CD-ROM, and
the HP Web site at
www.hp.com/jornada/solutions
The Getting Started with Microsoft
ActiveSync booklet or ActiveSync Help
on your desktop PC. For more details
and the latest updates, visit the Microsoft
Web site at www.pocketpc.com
The Readme files in the Microsoft
ActiveSync folder on your desktop PC
and CD-ROM, and the HP Jornada Web
site at www.hp.com/jornada
.
.
.
Page 12
8 | HP Jornada 520 Series User’s Guide
For information on: See this source:
Troubleshooting connections
The latest on Windows–
powered Pocket PCs
The complete text of this User's Guide is also available on the HP Web site at
www.hp.com/jornada/products/product_tour
Guide to your desktop PC and view it using the Adobe Acrobat Reader,
available from the Adobe Web site at www.adobe.com.
Chapter 9 of this User’s Guide or the
ActiveSync Troubleshooter on your
desktop PC. On the ActiveSync
menu, click
then click
Microsoft Web site at
www.pocketpc.com
The Microsoft Windows for Pocket PC
Web site at www.pocketpc.com.
Connection Settings
. For more help, visit the
Help
.
. You can download the User's
File
, and
8VLQJRQOLQH+HOSRQ\RXU+3-RUQDGD
You can get help for specific programs and for Windows for Pocket PC by
tapping
display a menu of all Help files available on your Pocket PC, tap the
menu, and then tap
screen is active.
Navigate in Help just as you navigate in Microsoft Internet Explorer: by tapping
links or tapping the Back button. When you have finished viewing Help, tap
to return to the program you were using.
Help
on the
Start
All Installed Help
menu. Help is displayed for the active program. To
View
, or simply tap
while the Today
Help
Page 13
_*HWWLQJVWDUWHG
This chapter will help you start using your HP Jornada Pocket PC. You will
become familiar with the hardware, learn how to set up your HP Jornada, and
find a brief introduction to the Windows for Pocket PC operating system. When
you finish this chapter, you will have all the information you need to begi n
working with your HP Jornada.
This chapter includes step-by-step instructions to help you
Identify hardware features.
•
Complete the Welcome Wizard.
•
Navigate in Windows for Pocket PC.
•
Enter information.
•
Find and organize information.
•
| 9
Page 14
10 | HP Jornada 520 Series User’s Guide
+DUGZDUHIHDWXUHV
The illustrations below introduce you to the various buttons, connectors, ports,
and other features of your HP Jornada.
4
5
6
7
8
9
1. Stylus.
2. Carrying pouch.
3. Stylus slot.
4. Rubber studs. Remove the studs to add
an accessory cover. Note that once
removed, the rubber studs cannot be
replaced.
5. Microphone.
6. Action button. Press to select the highlighted item, or rock to the button to
scroll up or down in a document.
7. Record button. Hold while recording.
8. HP hot keys. Press to open an
application.
14
13
12
11
10
9. Serial port. Connect to your
desktop PC using a sync cable
or cradle.
10. DC jack.
11. On/Off button.
12. Speaker.
13. Touch screen.
14. Notification LED. Signals an
alarm or reminder and
indicates power status while
recharging.
1
2
3
Page 15
Chapter 2 | Getting started | 11
15. Reset button.
16. Stereo headphone jack.
17. CompactFlash card slot. Add
memory or accessories using
Type I CompactFlash cards.
15
18. Infrared port. Transfer files
and data between other
devices without using wires or
16
17
18
cables.
HP home menu
Contacts
Calendar
The HP hot keys
Tasks
&DULQJIRU\RXU+3-RUQDGD
When treated properly, your HP Jornada will be a reliable desktop PC
companion. Follow these tips to ensure long and trouble-free use:
Protect the screen.
•
the screen. To protect the screen, keep your HP Jornada in the carrying
pouch while you are not using it. You can also protect the screen with an
optional screen protector or a color cover. For more information, see “HP
branded accessories” in chapter 8.
Pressing too hard on the touch screen may damage
Page 16
12 | HP Jornada 520 Series User’s Guide
Use the stylus to tap the HP Jornada screen to avoid scratches or
damage to the screen. To clean the screen, use a small amount of
commercial glass cleaner sprayed on a soft cloth. Avoid spraying the
screen directly.
Be sure to turn off your HP Jornada before cleaning the touch screen.
Do not drop your HP Jornada.
•
cause damage to delicate components such as the display. Accidental
damage is not covered under the Hewlett-Packard express warranty.
Avoid radiated interference.
•
equipment may affect the appearance of the display of your HP Jornada.
Removing the source of the interference will return the display to normal.
Avoid high temperatures.
•
temperatures between 0 to 40 ºC (32 to 104 ºF). Subjecting the device to
temperatures outside this range may damage the unit or result in loss of
data. Be especially careful not to leave your HP Jornada in direct sunlight
or in a car where temperatures can rise to harmful levels.
Dropping or jarring your HP Jornada can
Radiated interference from other electronic
Your HP Jornada is designed to operate at
8VLQJ\RXU+3-RUQDGDIRUWKHILUVWWLPH
Follow these steps to begin using your HP Jornada.
1.
Connect to ac power.
the dc jack on your Pocket PC.
Assemble the ac adapter, and connect it to
Page 17
Chapter 2 | Getting started | 13
2.
Reset your HP Jornada.
Press the red Reset button on the back of
your Pocket PC.
3.
Follow the Welcome Wizard.
The first time you start your HP
Jornada, the Hewlett-Packard Welcome screen appears. Then, after
a few moments, the Welcome Wizard begins. The Welcome Wizard
presents a brief orientation to Windows for Pocket PC, helps you
align the touch screen, and prompts you to select your city and time
zone.
4.
Adjust the display.
Before you begin, you may need to adjust the
contrast and brightness of the display to a comfortable level. Press
and hold the HP home menu hot key until HP settings appears, and
then move the sliders for each setting.
5.
Register your HP Jornada.
To ensure that you receive warranty
coverage, technical support, and information on upgrades, register
your HP Jornada at www.hp.com/jornada
.
Page 18
14 | HP Jornada 520 Series User’s Guide
7XUQLQJ\RXU+3-RUQDGDRQDQGRII
One of the most convenient features of HP Jornada is “instant on.” With
instant on, there is no waiting for HP Jornada to start up or shut down; you can
start working immediately by pressing the On/Off button.
You can also turn on your HP Jornada simply by tapping the touch screen. On
the
Preferences
box.
When you are finished working, turn off your HP Jornada by pressing the
On/Off button. By default, the backlight will dim after 1 minute of inactivity, and
your HP Jornada will turn off automatically after 3 minutes of inactivity if it is
not connected to an ac power source. You can use the Power control panel to
change these settings. On the
and then tap the Power icon.
tab in HP settings, select the
menu, tap
Start
Tap screen to power on
Settings
, tap the
System
check
tab,
If you select
on when you slide it into the carrying pouch.
Tap screen to power on,
your HP Jornada may accidentally turn
8VLQJWKHKDUGZDUHEXWWRQVDQG/('
The hardware buttons on your HP Jornada (that is, the buttons on the device
itself, rather than buttons or icons that appear on the display) can be used to
start a particular program and to turn on your HP Jornada. The features
associated with each button are described below. In addition, most buttons
can be reassigned or configured to start a program that you designate. For
more information, see “Configuring hardware buttons” in chapter 5.
1RWLILFDWLRQ/('
A blinking green LED indicates an alarm or reminder. The LED continues
•
blinking until you tap
While your HP Jornada is connected to ac power, an amber LED
•
indicates that your HP Jornada is charging. A solid (not blinking) green
LED indicates that your HP Jornada is fully charged.
A blinking amber LED indicates that the display is off (but the device is
•
still on).
Snooze
or
Dismiss
on the touch screen.
Page 19
5HFRUGEXWWRQ
Press and release the Record button to turn on your HP Jornada.
•
Press and hold the Record button to turn on your HP Jornada and begin
•
recording. If the speaker is not muted, a beep indicates that recording has
started.
Release the Record button to stop recording. If the speaker is not muted,
•
a double beep indicates that recording has stopped.
To avoid inadvertently turning on your HP Jornada, you can disable the
Record button. For more information, see “Adjusting settings” in chapter 5.
+3KRWNH\V
Press any HP hot key to start the associated application:
•
HP home menu hot key
Contacts hot key
Calendar hot key
Tasks hot key
Press the HP home menu hot key to launch the HP home menu.
•
Press the HP home menu hot key a second time to display the second
•
page of buttons.
Press and hold the HP home menu hot key to launch HP settings.
•
Press the Calendar, Contacts, or Tasks hot key to launch that application.
•
In Calendar, Contacts, or Tasks, press the associated hot key again to
•
change views (for example, to switch from Day view to Week view).
Press and hold the Tasks hot key to turn the display off (without turning
•
off the device). Press the Tasks hot key (when device is off) to turn the
display on again.
You can also set the HP hot keys to turn on your HP Jornada and start
•
the associated application with one touch. For more information, see
“Adjusting settings” in chapter 5.
Chapter 2 | Getting started | 15
Page 20
16 | HP Jornada 520 Series User’s Guide
2Q2IIEXWWRQ
Press the On/Off button to turn your HP Jornada on or off.
•
If the display has been turned off, press the On/Off button to turn on the
•
display.
Press and hold the On/Off button to open the Align Screen application
•
and recalibrate the stylus and touch screen. For more information, see
“Aligning the touch screen” later in this chapter.
1DYLJDWLQJLQ:LQGRZVIRU3RFNHW3&
8VLQJWKHVW\OXV
Use the stylus to navigate and select objects on the screen:
. Touch the screen once with the stylus to open items and select
• Tap
options.
• Drag
• Tap-and-hold
For convenience, the stylus is stored in the stylus slot on the carrying pouch of
your HP Jornada.
. Hold the stylus on the screen and drag to select text and images.
Drag in a list to select multiple items.
. Tap and hold the stylus on an item to see a list of actions
available for that item.
$OLJQLQJWKHWRXFKVFUHHQ
From time to time, you might notice that the accuracy of your stylus taps
diminishes. When this happens, you can realign your touch screen using the
Align Screen control panel.
=XXYNW]QN*URPW<L[NNWLXW][XUYJWNU
1. On the
2. On the
3. Tap the targets as they appear at each new location to calibrate the
You can also open the Align Screen control panel—without using the stylus—
by pressing and holding the On/Off button.
touch screen.
menu, tap
Start
System
Settings
tab, tap the Align Screen icon.
.
Page 21
Chapter 2 | Getting started | 17
7RGD\VFUHHQ
When you turn on your HP Jornada for the first time each day (or after 4 hours
of inactivity), you will see the Today screen. You can also display it by tapping
on the
Today
information about your day. To customize the information that is displayed, tap
the Today screen header.
menu. The Today screen displays all the important
Start
The Today screen
6ZLWFKLQJSURJUDPV
Use the HP home menu application or the
favorite programs or open frequently used documents. You can also use HP
task switcher to switch between running programs.
=X\]J[]X[\`R]LQY[XP[JV\^\RWP19QXVNVNW^
1. Press the HP home menu hot key.
2. Tap the button that corresponds to the program or document.
menu to quickly launch your
Start
Page 22
18 | HP Jornada 520 Series User’s Guide
HP home menu displays two pages of buttons and icons that represent the
programs and documents on your Pocket PC. To display the second page,
press the HP home hot key a second time, or tap the HP home menu icon in
the lower-right corner of the HP home menu screen.
The icons displayed on the buttons assigned to the Memory control panel and
Power control panel change to indicate when storage memory is low or power
is low.
=X\]J[]X[\`R]LQY[XP[JV\^\RWP]QN<]J[]VNW^
1. Tap in the Navigation bar to display the
2. On the
to.
–or–
Tap one of the miniature icons at the top of the
You can customize both HP home menu and the
to access the programs you use most. For more information, see “Configuring
menus” in chapter 5.
to a recently used program.
menu, tap the name of the program you want to switch
Start
Start
menu.
Start
menu to switch
Start
menu to make it easier
=X\`R]LQY[XP[JV\^\RWP19]J\T\`R]LQN[
1. On the Today screen, tap the HP task switcher status icon in the
Command bar.
–or–
Press the HP home menu hot key and tap the HP task switcher icon.
2. On the pop-up menu, tap the name of one of the running programs.
1DYLJDWLRQEDU
The Navigation bar is located at the top of the screen. It displays the active
program and current time, and allows you to switch to other programs and
close screens.
The Windows for Pocket PC Navigation bar
Page 23
Chapter 2 | Getting started | 19
&RPPDQGEDU
Use the Command bar at the bottom of the screen to perform tasks in
programs. The Command bar includes the menus and buttons for the active
program, status icons, and the Input panel button. To create a new item in the
current program, tap
To see the name of a button, tap and hold the stylus on the button. Drag the
stylus off the button so that the command is not carried out.
The Windows for Pocket PC Command bar
New
.
6WDWXVLFRQV
When the Today screen is displayed, you may see the following status ic ons
on the Command bar. In most cases, you can tap a status icon to display the
associated control panel or more information related to the item. For example,
tap the active dial-up connection icon to disconnect from a modem connection.
Icon Meaning
Speaker is on.
Pocket PC is charging.
Less than 50% power remains.
Power is very low. A warning message also appears.
External (ac) power source is connected.
Dial-up connection is active.
Direct connection to a desktop PC is active.
HP task switcher is active.
HP game buttons are enabled.
Page 24
20 | HP Jornada 520 Series User’s Guide
3RSXSPHQXV
Use pop-up menus to choose an action for the selected item. For example,
you can use the pop-up menu in the Contact list to quickly delete a contact,
make a copy of a contact, or send an e-mail message to a contact. The
actions on the pop-up menus vary from program to program. To open a popup menu, tap and hold the stylus on the item that you want to perform the
action on. When the menu appears, lift the stylus, and then tap the action you
want to perform. Tap anywhere outside the menu to close the menu without
performing an action.
The pop-up menu for Tasks
(QWHULQJLQIRUPDWLRQ
You have several options for entering information on your Pocket PC:
Use the soft keyboard on the Input panel to enter text.
•
Use the Character Recognizer on the Input panel to enter text.
•
Write directly on the screen.
•
Speak into the microphone to record a voice note.
•
Page 25
Chapter 2 | Getting started | 21
6RIWNH\ERDUG
The soft keyboard is an onscreen keyboard displayed at the bottom of the
screen. Tap a letter on the keyboard to enter that letter, just as if you were
typing.
=XMR\YUJb]QN\XO]TNbKXJ[M
1. Tap the Input panel icon at the right edge of the Command bar.
The icon may look like either a keyboard or a pen, depending on which input
option you have selected. If
Recognizer is selected), tap the arrow to the right of the Input panel icon, and
then tap
•
Keyboard
To display a numeric keypad, tap at the upper-left corner of the soft
keyboard.
.
is displayed (meaning that the Character
To type accented characters, tap
•
keyboard. The display shows the available accented characters.
To type capital letters, tap the V key.
•
To use keyboard shortcuts, such as F9for Paste or F=for Undo,
•
tap the Fkey, and then tap the letter of the command.
To change the size of the onscreen keys and set other options for the soft
keyboard, tap the arrow next to the Input panel icon and then tap
use the Input control panel.
The Input panel icon and menu
at the lower-left corner of the soft
Options
, or
Page 26
22 | HP Jornada 520 Series User’s Guide
&KDUDFWHU5HFRJQL]HU
The Character Recognizer is an onscreen writing area that interprets the
strokes of your stylus on the screen into typed letters in the active document.
You use the stylus to write in the Input panel, just as if you were writing on a
piece of paper.
=XMR\YUJb]QN,QJ[JL]N[;NLXPWRcN[
1. Tap the Input panel icon at the right edge of the Command bar.
The Input panel icon may look like either a keyboard or a pen, depending on
which input option you have selected. If
keyboard is selected), tap the arrow to the right of the Input panel icon, and
select
Character Recognizer
.
is displayed (meaning that the soft
The Character Recognizer input screen
To enter capital letters, write in the area at the left of the Input panel under
•
the “ABC” symbol.
To enter lowercase letters, write in the center portion of the Input panel,
•
under the “abc” symbol.
To enter numbers and symbols, write in the area at the right of the Input
•
panel, under the “123” symbol.
To enter symbols, tap the “@$” symbol to display an onscreen keyboard.
•
Page 27
Chapter 2 | Getting started | 23
Because certain letters use similar stylus strokes, it may take some practice to
achieve the writing style for the Character Recognizer. For a table of stylus
motions and the corresponding letters, see Appendix A, “Character
recognition.”
For a demonstration of proper stylus motions, tap
To select either uppercase or lowercase writing style and set other options for
the Character Recognizer, tap the arrow next to the Input panel icon and then
tap
Options
, or use the Input control panel.
.
:ULWLQJRUGUDZLQJRQWKHVFUHHQ
Some programs, such as Pocket Word, Notes, and the Notes tabs in
Calendar, Contacts, and Tasks, accept writing directly on the screen. When
you write on the screen, you can edit and format what you have written or
convert the information to text.
=X`[R]NXW]QN\L[NNW
1. Tap to switch to writing mode.
2. Write on the screen using the stylus, as you would write on paper.
=XLXW_N[]`[R]RWP]X]Na]
1. Next to the writing you want to convert, tap and hold the stylus until
the insertion point appears.
2. Without lifting the stylus, drag it to select the writing.
3. On the
4. If the conversion is incorrect, tap and hold the stylus on the incorrect
word to display the pop-up menu, and then tap
word you want to use, or tap the writing at the top of the menu to
return to the original writing.
Tips for writing on the screen:
Tools
menu, tap
Recognize
.
Alternates
. Tap the
Write neatly.
•
Write on the lines and draw descenders below the line. Write the cross of
•
the “t” and apostrophes below the top line so that they are not confused
with the word above. Write periods and commas above the line.
Page 28
24 | HP Jornada 520 Series User’s Guide
For better recognition, try increasing the zoom level to 300% using the
•
menu.
Tools
Write the letters of a word close together and leave big gaps between
•
words, so that it is clear where words begin and end.
Hyphenated words, foreign words that use special characters such as
•
accents, and some punctuation cannot be converted.
If you add writing to a word to change it (such as changing a “3” to an “8”)
•
after you attempt to recognize the word, the writing you added will not be
included if you attempt to recognize the writing again.
=XM[J`XW]QN\L[NNW
1. Tap to switch to writing mode.
2. Draw on the screen using the stylus, being sure to cross three ruled
The first stroke of your drawing must cross three horizontal rules.
lines on your first stroke.
3. Continue drawing, as you would draw on paper, making sure that
subsequent strokes appear in or touching the drawing box.
You may want to change the zoom setting so that you can more easily work
on or view your drawing. Tap
and then select a zoom setting.
Tools
Page 29
Chapter 2 | Getting started | 25
5HFRUGLQJYRLFHQRWHV
In any program where you can write or draw on the screen, you can also
quickly capture thoughts, reminders, and phone numbers by recording a voice
note. In Calendar, Tasks, and Contacts, you can include a recording on the
tab. In the Notes program, you can either create a standalone recording
Notes
or include a recording in a written note. If you want to include the recording in
a note, open the note first.
You can share voice notes with other Windows-powered devices by sending
them over infrared or as an attachment to an e-mail message.
The recording feature is intended for recording personal voice notes. It is not
suitable for recording presentations, music, or lectures. Some static or
electrical noise may be heard during playback.
=XL[NJ]NJ[NLX[MRWP
1. Press and hold the Record button until you hear a beep. The LED
glows amber.
2. While holding the Record button, speak into the microphone. For best
results, limit the length of recordings to less than 3 minutes. To create
the highest quality recordings, record in a location with low levels of
ambient noise, and speak in a normal voice with your mouth
approximately 10 cm (4 inches) from the microphone.
3. Release the Record button. Two beeps will sound. The new
recording appears in the note list or as an embedded icon.
You can also record a voice note by tapping
=XYUJbJ[NLX[MRWP
1. Tap the name of the recording in the file list.
–or–
Tap the recording icon in the note.
–or–
Press the Action button to play the selected recording.
on the Recording toolbar.
Page 30
26 | HP Jornada 520 Series User’s Guide
;NLX[MRWPOX[VJ]\
Your HP Jornada supports several formats for voice notes. The formats vary in
both the quality of the recording and the size of the sound file. When selecting
a recording format, you should consider the quality you need as well as how
much storage memory the recording will use on your HP Jornada.
In addition, not all recording formats are compatible with other software or
computers. If you will share your recordings with others or transfer a recording
to your desktop PC, be sure to choose a recording format that is supported by
the software used to play recordings on the other computer. The default
recording format is HP Dynamic Voice. For instructions on installing HP
Dynamic Voice codec on your desktop PC, see “Installing the HP Dynamic
Voice audio codec” in chapter 3.
=X\NUNL]J[NLX[MRWPOX[VJ]
1. On the
2. On the
recording format from the drop-down list.
The table below lists the compatibility of various recording formats with other
computers. The list of recording formats on your HP Jornada indicates the
sample rate, whether the format is stereo or mono, and how much storage
memory is required per second of recording. You may need to experiment with
different sample rates and formats to determine which format best suits your
voice.
Format Quality
PCM High yes yes yes yes
Mobile Voice Low yes yes yes no
GSM 6.10 Medium yes yes no no
HP Dynamic Voice High yes no yes* yes*
menu, tap
Start
Options
Settings
, and then tap the Input icon.
tab in the Input control panel, select a voice
Compatibility
HP Jornada
520 series
Pocket PC
Windows
CE 2.0
device
PC with
ActiveSync
installed
Windows
95/98/NT/
2000/Me
* You must first install HP Dynamic Voice codec on your desktop PC. See “Installing the
HP Dynamic Voice audio codec” in chapter 3
Page 31
Chapter 2 | Getting started | 27
=X\NWMJ[NLX[MRWP]XJWX]QN[LXVY^]N[
1. In the Notes application or in File Explorer, locate the recording you
want to send.
2. Tap and hold the name of the recording to display the pop-up menu.
3. On the pop-up menu, tap either
Infrared
4. Enter an e-mail address.
–or–
Align the infrared port on your HP Jornada with the infrared port on
the recipient’s computer. (The recipient’s computer must be in
infrared receive mode.)
.
Send via E-mail
or
Send via
)LQGLQJDQGRUJDQL]LQJLQIRUPDWLRQ
You can find and organize the files and information on your Pocket PC in
much the same way you do on your desktop PC: by using the Find feature or
by using File Explorer.
Use the Find feature to locate files that contain a specified text string or that
match specific criteria.
=XORWMJORUN
1. On the
2. In the
3. If you want to narrow your search to files of a specific type, select the
file type in the
4. Tap Go.
menu, tap
Start
box, type the text you want to locate.
Find
list.
Type
Find
.
To quickly find information that is taking up storage space on your device,
select
Larger than 64 KB
Use File Explorer to browse the folders on your Pocket PC and to organize
files into folders.
in the
Type
list.
=XK[X`\NOXUMN[\
1. On the
Start
menu, tap
Programs
, and then tap
File Explorer
.
Page 32
28 | HP Jornada 520 Series User’s Guide
Page 33
_&RQQHFWLQJWR\RXU
GHVNWRS3&
To get the most from your HP Jornada, you will want to connect to your
desktop or notebook PC. This chapter describes how to establish the
connection between your HP Jornada and your desktop PC, and ho w to
synchronize and transfer files between your Pocket PC and your desktop (or
any PC that has Microsoft ActiveSync installed). In this chapter, you will learn
to
Install Microsoft ActiveSync 3.1 on your desktop PC.
•
Connect your HP Jornada by sync cable, cradle, or infrared.
•
Establish a partnership between your HP Jornada and your desktop PC.
•
Synchronize data between your HP Jornada and desktop PC.
•
Browse files on your HP Jornada from your desktop PC.
•
Transfer files between your HP Jornada and a desktop PC.
•
Back up the data on your HP Jornada.
•
| 29
Page 34
30 | HP Jornada 520 Series User’s Guide
,QVWDOOLQJ0LFURVRIW$FWLYH6\QFRQ\RXUGHVNWRS3&
Before you can connect your HP Jornada to a desktop PC, you must install
Microsoft ActiveSync on the desktop PC. Microsoft ActiveSync enables you to
browse, synchronize, and transfer files between your desktop PC and your HP
Jornada.
Microsoft ActiveSync 3.1 is included on the ActiveSync CD-ROM, which
comes with your HP Jornada. For instructions on installing ActiveSync, refer to
the Getting Started with Microsoft ActiveSync booklet that accompanies the
CD-ROM. For information on using ActiveSync, see ActiveSync Help on your
desktop PC after you have installed the program.
Check the Microsoft Web site for updates to the ActiveSync software.
6\VWHPUHTXLUHPHQWV
The minimum desktop PC system requirements for installing and running
Microsoft ActiveSync 3.1 are as follows:
Microsoft Windows 2000, Microsoft Windows NT® Workstation 4.0 with
•
Service Pack 3 or later, Microsoft Windows Me, or Microsoft Windows
95/98
Pentium processor for Windows NT or Windows 2000 (166 MHz required
•
for Windows 2000; 150 MHz required for Windows Me); 486/66 DX or
higher processor (Pentium P90 recommended) for Windows 95/98
16 MB of memory for Windows 95/98 (more memory will improve
•
performance) or Windows NT (32 MB recommended) or Windows 2000
(64 MB recommended); 32 MB of memory for Windows Me
hard disk drive with 10 to 50 MB of available hard disk space (actual
•
requirements will vary based on selection of features and your current
system configuration)
available 9- or 25-pin communications port (adapter required for 25-pin
•
communication port) or infrared port
CD-ROM drive
•
VGA graphics card or compatible video graphics adapter at 256 colors or
•
higher
keyboard
•
Microsoft Mouse or compatible pointing device
•
Page 35
Chapter 3 | Connecting to your desktop PC | 31
Optional components
audio card/speakers for sound
•
modem and/or Ethernet LAN connection for remote synchronization
•
Microsoft Internet Explorer 4.0 or higher for Mobile Channels or Mobile
•
Favorites support. (Internet Explorer 5.0 is included on the ActiveSync
CD-ROM.)
additional 153 MB of disk space for Microsoft Outlook 2000. 24 MB
•
system RAM recommended. (Microsoft Outlook 2000 is included on the
ActiveSync CD-ROM.)
,QVWDOOLQJWKH+3'\QDPLF9RLFHDXGLRFRGHF
HP Dynamic Voice is the default format for recording voice notes on your HP
Jornada. You can transfer recordings from your HP Jornada to your desktop
PC; however, before you can play a voice note recorded in HP Dynamic Voice
on your desktop PC, you must install the HP Dynamic Voice compressor/
decompressor (codec). The procedure for installing the codec depends on
your operating system. Follow the appropriate instructions below for your
version of Microsoft Windows.
=XRW\]JUU19-bWJVRL?XRLNXW@RWMX`\""!6N
1. Insert the HP Jornada CD-ROM into a drive on your desktop PC.
2. In the HP Dynamic Voice folder on the HP Jornada CD-ROM, open
the Win9x folder.
3. Right-click the hpdynv.INF file, and then click
menu.
4. If you are prompted to insert a disk, make sure that your HP Jornada
CD-ROM is inserted, and then click OK.
5. Installation should begin automatically, and you should see the
Copying Files
6. If you see a message stating that the hpdynv.acm file is not found,
click
Browse,
Dynamic Voice folder on the HP Jornada CD-ROM.
dialog box.
and then select the file from the Win9x folder in the HP
=XRW\]JUU19-bWJVRL?XRLNXW@RWMX`\7=
1. Insert the HP Jornada CD-ROM into a drive on your desktop PC.
2. On the
3. In Control Panel, click
4. On the
5. Click
Add
menu, point to
Start
Devices
.
Multimedia.
tab, select
Settings
Audio Compression CODEC
, and then click
on the pop-up
Install
Control Panel
.
.
Page 36
32 | HP Jornada 520 Series User’s Guide
6. Select Unlisted or Updated Driver from the list, and then click OK.
7. Click
8. In the
9. In the
10. Click OK. The
11. Click OK. The
12. Click
Browse
ROM.
then select the WinNT directory.
downloading HP Dynamic Voice.
display “Hewlett Packard Dynamic Voice”.
OK
.
list, select the drive that contains the HP Jornada CD-
Drives
Directories
to install the codec onto your desktop PC.
list, open the HP Dynamic Voice directory, and
Install Driver
Add Unlisted or Updated Driver
dialog box should display the path for
dialog box should
=XRW\]JUU19-bWJVRL?XRLNXW@RWMX`\
1. Insert the HP Jornada CD-ROM into a drive on your desktop PC.
2. On the
1. In Control Panel, double-click the
2. On the
3. On the
click
Next
4. On the
device
5. In the list of devices, select
6. In the
the hardware from a list
7. In the list of Hardware types, select
controller
8. In the
click
Browse
9. In the
ROM.
10. In the
the Win2000 folder, and then click OK.
11. If the
12. In the
13. Click
14. If the
15. Click
Digital Signature Not Found
continue installation.
Dynamic Voice
Next
Digital Signature Not Found
continue installation.
Finish
menu, point to
Start
Hardware
Welcome to the Add/Remove Hardware Wizard
.
Choose a Hardware Task
, and then click
Find New Hardware
, and then click
Select a Device Driver
Drives
Directories
Select a Device Driver
tab, click
.
list, select the drive that contains the HP Jornada CD-
list, open the HP Dynamic Voice directory, select
, and then click
to start installation.
to complete the installation.
Settings
Hardware Wizard
.
Next
Add a new device
dialog box, select
, and then click
Next
, and then click
System
.
dialog box, click
screen, select
Next.
icon.
.
screen, click
Sound, video and game
dialog box appears, click
dialog box appears, click
Add/Troubleshoot a
, then click
No, I want to select
.
Next
Have Disk
Hewlett-Packard
Control Panel
screen,
.
Next
, and then
to
Yes
to
Yes
.
Page 37
Chapter 3 | Connecting to your desktop PC | 33
&RQQHFWLQJ\RXU+3-RUQDGD
You can connect your HP Jornada to a desktop or notebook computer in three
ways:
Use a sync cable to connect to a serial port.
•
Use a serial cradle to connect to a serial port.
•
Use the infrared port on your Pocket PC (if the desktop or notebook
•
computer also has an infrared transmitter).
Each of these methods works with all models of the HP Jornada Pocket PC.
Serial sync cradle and additional sync cables are available as optional
accessories. Both serial and infrared connections work with Windows 95,
Windows 98, and Windows 2000. Windows NT supports serial connection, but
does not support connection by infrared.
Serial connections require a 9-pin serial communications (COM) port on your
desktop PC. If the 9-pin serial port is in use by another device, or if your
desktop PC has no 9-pin serial port, obtain an adapter from your computer’s
manufacturer.
&RQQHFWLQJE\V\QFFDEOH
If a sync cable was not included with your HP Jornada, you can purchase a
serial cable as an optional accessory. For more information, see the HP
Jornada Accessories Guide.
=XLXWWNL]Kb\bWLLJKUN
1. Connect the sync cable to a serial port on your desktop PC.
2. Connect the other end of the sync cable to your HP Jornada. Your
HP Jornada should start automatically and establish a connection to
the desktop PC.
Page 38
34 | HP Jornada 520 Series User’s Guide
&RQQHFWLQJE\FUDGOH
If a cradle was not included with your HP Jornada 520 Series Pocket PC, you
can purchase a serial cradle as an optional accessory. For more information,
see the HP Jornada Accessories Guide.
=XLXWWNL]KbL[JMUN
1. Connect the dc plug from the ac adapter to the dc jack on the cradle
cable, and plug the ac adapter into a wall outlet.
2. Connect the cable from the cradle to a serial port on your desktop
PC.
3. Slide your HP Jornada into the cradle. Your HP Jornada should start
automatically and establish a connection to the desktop PC.
Page 39
Chapter 3 | Connecting to your desktop PC | 35
When you remove your HP Jornada from the cradle, hold the cradle down with
one hand and gently lift the HP Jornada with the other to avoid putting stress
on the connectors.
&RQQHFWLQJE\LQIUDUHG
The infrared port on your HP Jornada provides a convenient way to connect to
an IrDA-equipped PC without using a cable or cradle. Many notebook
computers have built-in infrared ports; however, you may need to install and
configure an infrared port on a desktop PC. To install the port, follow the
manufacturer’s instructions. More information about infrared drivers for
Microsoft Windows is available on the Windows for Pocket PC Web site at
www.pocketpc.com
.
Page 40
36 | HP Jornada 520 Series User’s Guide
For complete instructions on connecting to your desktop PC by infrared, refer
to ActiveSync help on your desktop PC.
(VWDEOLVKLQJDSDUWQHUVKLS
When you install Microsoft ActiveSync, you are prompted to connect your HP
Jornada and create a partnership. A partnership enables your desktop PC to
recognize your HP Jornada when you connect and to remember the
synchronization and file conversion settings you set.
You can connect your HP Jornada to a desktop PC without establishing a
partnership; however, only Pocket PCs that have a partnership with a desktop
PC can synchronize information between the two computers.
Your HP Jornada can have partnerships with up to two desktop (or notebook)
PCs, for example, your home and office computers. If you regularly
synchronize your HP Jornada with both desktop PCs, you can ensure that
important files, contacts, and appointments are always up-to-date and identical
on all three computers.
Although you can establish partnerships with two desktop PCs, you can
synchronize e-mail messages with only one desktop PC.
A single desktop PC can have partnerships with many Pocket PCs or other
mobile devices. This is useful if you have more than one Windows-powered
device, or if several mobile professionals share a single desktop PC.
7KH1HZ3DUWQHUVKLS:L]DUG
The first time you connect, the New Partnership Wizard on your desktop PC
helps you establish a partnership and set options for synchronizing Pocket
Outlook data, e-mail messages, and files between your HP Jornada and
desktop PC.
=XN\]JKUR\QJYJ[]WN[\QRY
1. When the
screen, click
complete the New Partnership Wizard.
2. At the prompt, type a name and description for your HP Jornada. The
name must start with a letter, and it can be anything you choose (up
to 15 characters, no spaces).
New Partnership
to synchronize, and then follow the instructions to
Yes
dialog box appears on your desktop PC
Page 41
Chapter 3 | Connecting to your desktop PC | 37
You can later change the name and description on the
About control panel on your HP Jornada. On the
the
System
If you choose to establish partnerships with two desktop PCs, the two desktop
PCs must be configured with the same synchronization settings. In addition,
both desktop PCs must use the same PIM program (for example, Microsoft
Outlook).
tab, and then tap the About icon.
3. Set the number of partnerships your HP Jornada will have. If you will
synchronize information between your Pocket PC and more than one
computer, or if you have already established a partnership with
another desktop PC, select two.
4. Set options for synchronization, including the types of files and
information you want to synchronize and whether to synchronize
automatically each time you connect.
Start
Device ID
menu, tap
tab of the
Settings
6\QFKURQL]LQJGDWD
Synchronization compares the data on your HP Jornada with the data on your
desktop PC and updates both computers with the most recent information.
You can synchronize any of the files on your HP Jornada with the
corresponding files on your desktop PC. For example
Keep Pocket Outlook data up to date by synchronizing your Calendar,
•
Contacts, and Tasks databases with Microsoft Outlook on your desktop
PC.
Synchronize Microsoft Word and Microsoft Excel files between your
•
device and desktop PC. Your files are automatically converted to the
correct format.
Synchronize e-mail messages in your HP Jornada Inbox with e-mail
•
messages in Microsoft Outlook on your desktop PC.
Copy favorite Web site addresses* and any Web pages you have marked
•
for offline viewing in Microsoft Internet Explorer to your HP Jornada.
By default, ActiveSync synchronizes only Contacts, Calendar, Tasks, and your
Mobile Favorites. You can set synchronization options when you first establish
a partnership, or use ActiveSync options to turn synchronization on and off for
other files and information types.
, tap
* Modem must be purchased separately. Some Web sites/content may not be available.
Page 42
38 | HP Jornada 520 Series User’s Guide
Control
example, you can synchronize continually while your HP Jornada is
connected, or only when you choose the
Select which information types are synchronized and control how much data is
synchronized. For example, you can choose how many weeks of past
appointments you want synchronized.
synchronization occurs by selecting a synchronization mode. For
when
Synchronize
command.
5HVROYLQJV\QFKURQL]DWLRQFRQIOLFWV
If the same item (for example an appointment or a task) has been modified on
both your HP Jornada and desktop PC, ActiveSync indicates that a
synchronization conflict has occurred.
When the
to display the
specify one of the items to replace.
You can resolve each conflict manually at the time of synchronization, or you
can resolve conflicts automatically, by setting a default option for conflict
resolution.
Resolve items
Resolve Conflict
=X\N]JMNOJ^U]XY]RXWOX[LXWOURL][N\XU^]RXW
1. In the ActiveSync window on your desktop PC, click
menu.
Tools
2. On the
Rules
Resolution
message appears in the ActiveSync window, click it
dialog box. To resolve the conflict, you must
Options
tab, choose one of the options under
.
Conflict
on the
6\QFKURQL]LQJIURPDUHPRWHORFDWLRQ
You can synchronize while connected to your desktop PC by a dial-up
modem* connection or over a local area network (LAN). This can be useful if
you need to synchronize files or PIM information while traveling. Before you
leave, you must configure both your HP Jornada and your desktop PC.
8WbX^[193X[WJMJ
You must create a partnership between your HP Jornada and the deskto p PC
using one of the direct connection methods (serial cable or infrared
connection) described in this chapter. And you must configure a dial-up or
network connection on your HP Jornada, as described in chapter 4,
“Connecting to the Internet or to a network.”
* Modem must be purchased separately. Some Web sites/content may not be available.
Page 43
Chapter 3 | Connecting to your desktop PC | 39
8WbX^[MN\T]XY9,
Before you can synchronize remotely, the desktop PC or network server must
be configured to allow your HP Jornada to connect. If the desktop PC uses
Windows NT or Windows 2000, you must install and configure Remote Access
Services. If it uses Windows 95/98/Me, install and configure Dial-Up
Networking.
You must also ensure that ActiveSync is configured to allow a network
connection. By default, ActiveSync allows a network connection; however, to
confirm the setting or to enable connection if it has been disabled, follow the
procedure below.
=XNWJKUNJWN]`X[TLXWWNL]RXWRW*L]R_N<bWL
1. On the
2. Select
Follow these steps to prepare your desktop PC before you leave:
•
•
•
If you receive an error message on your HP Jornada that states that an
information type needs attention, or if unresolved items are reported after
synchronization, you need to synchronize directly with your desktop PC us ing
a serial cable, cradle, or infrared connection.
(RAS) server connection with this desktop computer
If you are using a modem on your desktop PC, turn the modem on before
you leave.
Leave your desktop PC on, and be sure you logged on und er the same
user name that you used when you created the partnership.
Ensure your PIM program and e-mail program (Microsoft Outlook or
Microsoft Exchange) are running.
menu, click
File
Allow network (Ethernet) and Remote Access Service
Connection Settings
.
.
%URZVLQJ\RXU+3-RUQDGDIURP\RXUGHVNWRS
While your HP Jornada is connected to a desktop PC, you can use ActiveSync
to browse the contents of your HP Jornada from your desktop PC. In the
ActiveSync window on your desktop PC, click
contents of your HP Jornada are displayed in the Mobile Device window.
You can also browse the contents of your HP Jornada from Windows Explorer
by double-clicking the Mobile Device icon in My Computer or in the drop-down
list of available drives.
While you browse, you can cut, paste, and copy files between folders on your
HP Jornada or transfer files between your HP Jornada and desktop PC simply
by dragging the file icons between folders.
Explore
on the
menu. The
File
Page 44
40 | HP Jornada 520 Series User’s Guide
You cannot open documents or start programs stored on your HP Jornada by
double-clicking their icons in the Mobile Device window on your desktop PC.
Double-clicking an icon displays the properties for that file.
7UDQVIHUULQJILOHVEHWZHHQ\RXU+3-RUQDGD
DQG\RXUGHVNWRS3&
You can copy files between your HP Jornada and desktop PC by dragging
icons to or from the Mobile Device window or by using the
commands on the
Paste
Files created on your desktop PC may need to be converted before you can
use them on your HP Jornada, and files created on your HP Jornada may
need to be converted before you can use them on your desktop PC. By
default, ActiveSync automatically converts files to the appropriate type;
however, you can choose not to convert files, or you can choose to specify the
conversions for each type of file by changing options in ActiveSync.
Edit
menu.
Cut, Copy
=X\N]ORUNLXW_N[\RXWXY]RXW\
1. Start ActiveSync on your desktop PC.
2. On the
3. On the
4. To turn off automatic conversion, clear the
synchronized, copied, or moved
Tools
Rules
menu, click
tab, click
Conversion Settings
Options
.
.
Convert files when
check box.
, and
%DFNLQJXSDQGUHVWRULQJGDWD
To prevent loss of data, you should back up your HP Jornada frequently. You
can back up your HP Jornada in two ways:
Use ActiveSync to back up all data to your desktop PC.
•
Use the HP backup application to back up all data or only your Contacts,
•
Calendar, and Tasks databases (PIM data) to a CompactFlash card or to
internal memory.
Backup files are not password-protected, even if you have set a password for
your HP Jornada. If you store sensitive information on your HP Jornada,
protect the backup file as you would any other file that contains sensitive
information.
Page 45
Chapter 3 | Connecting to your desktop PC | 41
%DFNLQJXSGDWDZLWK$FWLYH6\QF
When you back up your HP Jornada using Microsoft ActiveSync, the backup
file contains all the files, databases, PIM information, and RAM-based
programs on your Pocket PC. The backup file is stored on your desktop PC.
If you have established a partnership between your HP Jornada and desktop
PC, you can set ActiveSync to back up data automatically each time you
connect. You can also back up your HP Jornada manually any time you want.
ActiveSync lets you decide whether to back up all information each time, or
only new and updated information.
=XKJLT^YMJ]J`R]Q*L]R_N<bWL
1. Connect your HP Jornada to your desktop PC.
2. In the ActiveSync window on your desktop PC, click
on the
3. Select either
Incremental Backup
4. Click
location for your backup file.
5. Click
menu, and then click the
Tools
Full Backup
(to back up only new or updated information).
Change
Back Up Now
to change the name of your backup file or to specify a
.
Backup
(to back up all information every time) or
Backup/Restore
tab.
%DFNLQJXSGDWDZLWK+3EDFNXS
The HP backup application gives you added flexibility in backing up your
valuable data. With HP backup, you can back up all data or back up only your
Calendar, Contacts, and Tasks databases (PIM databases). You can save the
backup file to internal memory or to a CompactFlash card, so you can
safeguard your data even while you are traveling or away from your desktop
PC.
Backing up data to a file stored on your HP Jornada will not preserve your
data if your Pocket PC loses power or if you restore your HP Jornada to the
factory default settings. To ensure the safety of your data, it is recommended
that you back up to a CompactFlash card or to your desktop PC.
=XKJLT^YMJ]J^\RWP19KJLT^Y
1. Use HP task switcher to close all running applications. (In the Today
screen, tap the HP task switcher icon, and then tap
and
Close All
2. Discon nect your HP Jornada from your desktop PC.
3. On the
on the pop-up menu.)
menu on your HP Jornada, tap
Start
Settings
Close Window
.
Page 46
42 | HP Jornada 520 Series User’s Guide
4. Tap the
5. On the
databases
6. In the
storage location from the drop-down list.
7. Tap OK to start the backup.
The backup file (.dbe or .dbb) is always saved in the My Documents folder. If
you back up data to a CompactFlash card, a My Documents folder is
automatically created.
System
Backup
Name
tab, and then tap
tab, tap
.
box, type a name for the backup file, and select a
Back up all data
HP backup
.
or
Back up PIM
5HVWRULQJGDWD
When you use the backup file to restore information to your HP Jornada,
information on the device is replaced with the information stored in the backup
file. If you have created files on your HP Jornada since the last backup and do
not want to delete these files during the restore process, move the files from
your HP Jornada to your desktop PC before restoring information. You can
restore data using ActiveSync or the HP backup application.
5HVWRULQJGDWDZLWK$FWLYH6\QF
Restoring data from ActiveSync replaces all information stored on your HP
Jornada. Any data added after the backup file was created will be lost.
=X[N\]X[NMJ]J`R]Q*L]R_N<bWL
1. Connect your HP Jornada to your desktop PC.
2. Use HP task switcher to close all running applications on your HP
Jornada. (In the Today screen, tap the HP task switcher icon, and
then tap
3. In the ActiveSync window on your desktop PC, click
on the
4. Click
is complete.
5. Disconnect the sync cable or remove your HP Jornada from the
cradle, remove the CompactFlash card (if installed), and reset your
HP Jornada. See “Resetting your HP Jornada” in chapter 9.
Close Window
menu, and then click the
Tools
Restore Now
and
Close All
. Do not use your device until the restore process
on the pop-up menu.)
Backup/Restore
Restore
tab.
Page 47
Chapter 3 | Connecting to your desktop PC | 43
;N\]X[RWPRWL[NVNW]JUKJLT^Y\
If you have made incremental backups, you must restore each backup file
individually, starting with the original (full) backup and progressing in sequence
from the oldest to the most recent.
To select the backup file you want to restore, connect your HP Jornada to your
desktop PC as a guest. If you have already established a partnership, you
must delete the partnership on the desktop PC. (In ActiveSync, click
Partnership
on the
File
menu.)
5HVWRULQJGDWDZLWK+3EDFNXS
Use the HP backup application to replace all data on your Pocket PC or only
data in your Contacts, Calendar, and Tasks databases (PIM databases) with
data from an existing backup file.
Depending on the type of backup file, the restore operation replaces al l
information stored in your PIM databases or all data stored on your Pocket
PC. Any data added after the backup file was created will be lost.
=X[N\]X[NMJ]J`R]Q19KJLT^Y
1. Use HP task switcher to close all running applications. (In the Today
screen, tap the HP task switcher icon, and then tap
and
Close All
2. Discon nect your HP Jornada from your desktop PC.
3. Start HP backup on your HP Jornada.
4. On the
databases
5. In the file list, tap the name of a backup file you want to restore from.
6. Remove the CompactFlash card (if installed), and reset your HP
Jornada. See “Resetting your HP Jornada” in chapter 9.
on the pop-up menu.)
Restore
tab, tap
.
Restore all data
or
Close Window
Restore PIM
Delete
Page 48
44 | HP Jornada 520 Series User’s Guide
Page 49
_&RQQHFWLQJWRWKH,QWHUQHW
RUWRDQHWZRUN
In addition to connecting your HP Jornada to your desktop PC partner, you
may want to connect to remote computers so you can access e-mail, browse
the Internet, or retrieve files from a corporate network (LAN), whether you are
at home or on the road. This chapter describes
the several methods you can use to connect your HP Jornada to a
•
modem,* cellular phone, or network
the process of configuring your HP Jornada to connect to an Internet
•
service provider (ISP) or network
browsing the Web (or a corporate intranet) from your HP Jornada using
•
Microsoft Internet Explorer and Mobile Channels
sending and receiving e-mail messages with your HP Jornada
•
| 45
* Modem must be purchased separately. Some Web sites/content may not be available.
Page 50
46 | HP Jornada 520 Series User’s Guide
&RQQHFWLQJ\RXU+3-RUQDGD
Your HP Jornada gives you several options for connecting to a remote
computer. You can use an optional CompactFlash card modem, an infrared
modem, or a mobile phone. Each of these methods requires purchase of a
modem or adapter as an optional accessory. For more information about
compatible modems and accessories, visit the HP Jornada Web site at
www.hp.com/jornada/accessories
&RQQHFWLQJZLWKD&RPSDFW)ODVKFDUGPRGHP
Your HP Jornada Pocket PC supports a variety of Type I CompactFlash card
modems and network interface cards (NICs). Whether you use a CompactFlash card modem or CompactFlash NIC, the card must be a Type I
CompactFlash card. For a list of compatible CompactFlash cards, go to the
HP Jornada accessories page at www.hp.com/jornada/accessories
Many NICs also require that you install a software driver. The card manufacturer must provide a software driver for the HP Jornada Pocket PC. Follow
the card manufacturer’s instructions for installing the card and configuring the
driver for use with your HP Jornada.
.
.
The driver for the Socket Low Power Ethernet CF+ card NIC is preinstalled on
your HP Jornada.
After you have installed and configured the card, the make and model of the
card will appear in the list of modems or the list of network adapters when you
create a new connection (see “Creating an ISP or network connection” later in
this chapter).
When you are ready to connect, connect the CompactFlash card modem to an
analog telephone line or a network connection using the appropriate cable.
Follow the card manufacturer’s instructions to attach the cable to the port on
the card.
Do not connect a CompactFlash card modem to a digital telephone line unless
it is specifically designed for use with a digital line.
Page 51
Type I CompactFlash card slot
Chapter 4 | Connecting to the Internet | 47
&RQQHFWLQJZLWKDQLQIUDUHGPRGHP
You can also use the infrared port on your HP Jornada to connect to the
Internet or a remote computer via an IrDA-compatible infrared modem. When
you create a new dial-up connection, select
modem list. Connect the modem to a phone line according to the manufacturer’s instructions, and align the infrared port on your HP Jornada with the
infrared port on the modem before dialing the call.
Generic IrDA modem
from the
&RQQHFWLQJZLWKDPRELOHSKRQH
If your mobile phone service supports remote data connection, you can use
the mobile phone to connect your HP Jornada to the Internet or to a remote
computer. Depending on the make and model of your mobile phone, you can
connect your Pocket PC to the mobile phone using either a CompactFlash
card interface or the infrared port.
Page 52
48 | HP Jornada 520 Series User’s Guide
,XVYJL]/UJ\QLXWWNL]R_R]bTR]
You may be able to obtain a Type I CompactFlash connectivity kit from the
manufacturer of your phone, or from a third-party manufacturer. In either case,
the kit must be designed to work with the specific model of your phone, and
the manufacturer must provide a driver for use with the HP Jornada Pocket
PC.
After you have installed and configured the card, the make and model of the card will appear in the list of modems or the list of network adapters when you create a new connection (see “Creating an ISP or network connection” later in this chapter).
?RJRWO[J[NM
If your mobile phone has a built-in IrDA-compatible infrared port (or if an
optional infrared connectivity kit is available for your phone), you can use the
infrared port on your HP Jornada to connect to it. When you create a new dialup connection, select
infrared port on your HP Jornada with the infrared port on the mobile phone
before dialing the call. For detailed instructions on how to establish a wireless
connection using a mobile phone, check the HP Jornada Web site at
www.hp.com/jornada/solutions/hardware/wireless_solutions
Generic IrDA modem
from the modem list. Align the
.
&UHDWLQJDQ,63RUQHWZRUNFRQQHFWLRQ
To connect to a network or the Internet, you need an account with an ISP, an
account on your corporate network, or access permission to dial in to a
specific computer.
For each account, you will need a user name and password provided by the
ISP or account administrator. If you are connecting to a commercial ISP, you
will also need to know the dialup telephone number and IP and DNS
addresses (if required).
If you plan to use the account to send or receive e-mail messages directly
from your HP Jornada, you must also obtain the following information from
your ISP or account administrator:
a user name and password for your e-mail account (these may be
•
different than the user name and password you use to connect)
the name of the POP3 or IMAP4 server (for incoming messages)
•
the name of the SMTP server (for outgoing messages)
•
Page 53
Chapter 4 | Connecting to the Internet | 49
Before you can use a modem to connect to an ISP or to dial in to a specific
desktop PC, you must create a connection for that service on your HP
Jornada. If you use an NIC to connect to a corporate network, you must
configure your network connection. Your HP Jornada will recognize the
connection once you attach the network cable to the NIC.
=XL[NJ]NJMRJU^YLXWWNL]RXW]XJW2<9X[J\YNLRORL9,
1. Install a modem or NIC. For more information, see “Connecting your
HP Jornada” earlier in this chapter.
2. On the
3. Tap the Modem icon.
4. Tap
5. Enter a name for the connection. The name can be anything you
6. Select the make and model of your modem from the list. If your
7. Select the baud rate. The selected rate must be supported by both
8. If your ISP or account administrator provided specific settings, such
9. Tap
10. Tap
11. Tap
12. On the
To establish a connection, follow the procedure “To connect to an ISP or
desktop PC,” below.
New Connection
want, but it should describe the connection, for example, “corporate
dialup.”
modem is not listed, it may be installed incorrectly. Refer to the
manufacturer’s instructions to be sure.
your modem and the ISP or network computer you will connect to. If
you are not sure about the rate, contact your account administrator.
as IP addresses, DNS addresses, or parity or flow control—or if your
connection uses SLIP—tap
the appropriate tab.
Next
to your ISP or network computer.
Next
Finish
necessary options or dialing patterns. (For a description of dialing
strings and dialing options, see online Help on your HP Jornada.)
menu, tap
Start
, and then enter the telephone number you dial to connect
, and then set dialing options.
.
tab, select your dialing location and set any
Dialing
Settings
.
, and then tap the
Advanced
, and enter this information on
Connections
tab.
=XLXWORP^[NJWN]`X[TLXWWNL]RXW
1. On the
2. Tap the Network icon.
3. On the
NIC in the list of installed adapters.
menu, tap
Start
Adapters
tab, select the name of your CompactFlash card
Settings
, and then tap the
Connections
tab.
Page 54
50 | HP Jornada 520 Series User’s Guide
4. If your ISP or account administrator provided specific settings, such
as IP addresses or DNS addresses, enter this information on the
appropriate tab, and then tap OK.
5. On the
Identification
domain (if required).
tab, enter your user name, password, and the
=XLXWWNL]]XJW2<9X[MN\T]XY9,
1. On the
icon.
2. Tap the icon for the connection. All connections you have created
should appear as icons in the Connections folder.
3. Type your user name, password, and domain (if required).
4. Select a dialing location. Tap
settings for the selected location or to create a new location.
5. In the
necessary changes to the dialing pattern for this call. For an
explanation of dialing patterns, see online Help on yo ur HP Jornada.
6. Tap OK to close the
7. Tap
8. In the
Connect
is displayed. If the phone number is not displayed correctly, adjust
the settings in
menu, tap
Start
Dialing Options
Dialing Options
.
Connect To
dialog box, confirm that the proper phone number
Dialing Options
Programs
dialog box, tap
, and then tap the Connections
Dialing Options
or
Dialing Patterns
to confirm or change
Dialing Patterns
dialog box.
to make any
.
After you have set up an e-mail service, you can also connect to your e-mail
server from within Inbox. Select the appropriate service on the
menu, and then tap the Connect button (or tap
menu). For more information, see “Sending and receiving e-mail” later in this
chapter.
Connect
on the
Services
Services
%URZVLQJWKH:HERUDFRUSRUDWHLQWUDQHW
Once you are connected, you can browse the Internet or a corporate intranet
using Microsoft Pocket Internet Explorer, and you can download mobile
channels for offline viewing on your HP Jornada.
0LFURVRIW3RFNHW,QWHUQHW([SORUHU
You can use Microsoft Pocket Internet Explorer to browse mobile favorites and
channels that you have downloaded to your HP Jornada without con necting to
the Internet. Or, you can connect to the Internet (or a corporate network) to
browse the Web or a corporate intranet.
Page 55
The Pocket Internet Explorer home page
Chapter 4 | Connecting to the Internet | 51
=XK[X`\N]QN@NK
1. On the
2. Connect your HP Jornada to a modem or network. (See “Connecting
your HP Jornada” earlier in this chapter.)
3. On the
4. On the
5. If your ISP requires you to connect to a proxy server, select the
proxy server
server. For more information, consult your account administrator.
6. Tap OK to return to Internet Explorer, and then on the
tap
Connect
7. On the
–or–
Tap , and then tap the favorite you want to view.
8. To close the connection, tap
menu, tap
Start
menu, tap
Tools
Connections
Internet Explorer.
Options
, and then tap the
tab, select a connection from the
check box, and then enter the address of the proxy
.
View
menu, tap
Address Bar
Tools
, and then type an URL.
and then
Disconnect
Connections
Type
Tools
.
tab.
list.
Use
menu,
Page 56
52 | HP Jornada 520 Series User’s Guide
You can have Pocket Internet Explorer automatically connect to the Internet
when you attempt to access a page that is not stored on your HP Jornada. On
the
connection, and the select the
box.
Tools
menu, tap
Options
, and then tap the
Access remote content automatically
Connections
tab. Select a
check
&KDQQHOFRQWHQW
Channels are Web sites designed specifically for offline viewing on a Pocket
PC. You can subscribe to two types of channels at no fee: AvantGo Channels
and Mobile Channels provided by Microsoft partners.
*_JW]0X,QJWWNU\
AvantGo is a free interactive service that gives you access to personalized
content and thousands of popular Web sites. Unlike Mobile Channels, you can
subscribe to AvantGo Channels directly from your HP Jornada. AvantGo
Channels are downloaded to your HP Jornada when you synchronize with
your desktop PC or when you connect to the Internet. For more information,
or
.
Delete
Start
link.
.
link.
menu, tap
Options
AvantGo Channels
Settings
on the
, and then on the
menu,
Tools
to display
link in your list
visit http:\\avantgo.com\help
=X\RPW^YOX[*_JW]0X
1. In ActiveSync on your desktop PC, click
and then select the AvantGo information type.
2. In Pocket Internet Explorer on your HP Jornada, tap
your list of favorites.
3. Tap the
4. Tap
5. Follow the directions on your screen. You will need to synchronize
your HP Jornada with your desktop PC, and then tap the My
Channels button to complete AvantGo setup.
When synchronization is complete, tap the
of favorites to see a few of the most popular channels. To add or delete
channels, tap the
You can change settings for your AvantGo server or add a specific server for
AvantGo channels. On the
Connections
AvantGo Channels
Activating AvantGo
Add
tab, tap the AvantGo Connect icon.
Page 57
Chapter 4 | Connecting to the Internet | 53
6XKRUNLQJWWNU\
Mobile channels are sites you subscribe to on your desktop PC. They are
stored in the Channels subfolder in the Mobile Favorites folder of your
Microsoft Internet Explorer folder and are downloaded to your HP Jornada
during synchronization. To see a list of mobile channels you can subscribe to
at no fee, visit the Windows for Pocket PC Web page at www.pocketpc.com
While a channel Web page is displayed, click the Add Mobile Chann el button,
and then select
desktop PC. The mobile channel will be transferred to your device the next
time you synchronize.
Make available offline
to download the channel to your
.
=X_RN`LQJWWNU\
1. Tap to display your list of favorites.
2. Tap the channel you want to view.
Internet Explorer displays the page that was downloaded the last time you
synchronized with your desktop PC. If the page is not stored on your HP
Jornada, the favorite will be dimmed, and you must synchronize with your
desktop PC or connect to the Internet before you can view the page.
0RELOHIDYRULWHV
When you install ActiveSync, a subfolder called Mobile Favorites is created in
the Favorites folder on your desktop PC. You can synchronize the favorites in
this subfolder with the favorites on your HP Jornada. Unless you mark the
favorite link as a mobile favorite, only the link will be downloaded to your
device, and you will need to connect to your ISP or network to view the
content.
If you use Microsoft Internet Explorer 5 on your desktop PC, you can mark a
link as a mobile favorite, and then download your mobile favorites to your HP
Jornada. This enables you to view Web pages while you are disconnected
from your ISP and desktop PC. Use the Internet Explorer 5 plug-in installed
with ActiveSync to create mobile favorites quickly.
=XL[NJ]NJVXKRUNOJ_X[R]N
1. In Internet Explorer 5 on your desktop PC, click
Create Mobile Favorite
2. To change the link name, type a new name in the
3. If you want to update the page on a regular basis, select an update
schedule from the
.
Update
list.
Tools
Name
and then
box.
Page 58
54 | HP Jornada 520 Series User’s Guide
4. Click OK. Internet Explorer downloads the latest version of the Web
page to your desktop PC.
5. If you want to download the pages that are linked to the mobile
favorite you just created, in Internet Explorer on the desktop PC,
right-click the mobile favorite and then click
Download
6. Synchronize your device and desktop PC. Mobile favorites that are
stored in the Mobile Favorites folder in Internet Explorer 5 are
If you do not specify an update schedule in step 3, you must manually update
the information on your HP Jornada. Before you synchronize, in Internet
Explorer on your desktop PC, click
last time content was downloaded, and manually download content if needed.
downloaded to your device.
tab, specify the level of links you want to download.
and then
Tools
Properties
Synchronize
. On the
. Check the
You can add a button to the Internet Explorer toolbar for creating mobile
favorites. In Internet Explorer 5 on your desktop PC, click
then
Customize
.
View, Toolbars
, and
=X_RN`VXKRUNOJ_X[R]N\
1. Tap to display your list of favorites.
2. Tap the mobile favorite you want to view.
You will see the page that was downloaded the last time you
synchronized with your desktop PC. If the page is not on your device,
the favorite will be dimmed, and you will need to synchronize with
your desktop PC or connect to the Internet to view the page.
Page 59
Chapter 4 | Connecting to the Internet | 55
Mobile favorites
,XW\N[_RWPVNVX[b
Mobile favorites can use a lot of storage memory on your HP Jornada. Follow
these tips to minimize the amount of memory used:
Turn off pictures and sounds or stop some mobile favorites from being
•
downloaded to your HP Jornada. In ActiveSync on your desktop PC, click
Options
then click
Limit the number of downloaded linked pages. In Internet Explorer on the
•
desktop PC, right-click the mobile favorite you want to change, and then
click
linked pages you want to download.
on the
Settings
Properties
menu, select the Favorites information type, and
Tools
. For more information, see ActiveSync Help.
. On the
Download
tab, specify 0 or 1 for the number of
6HQGLQJDQGUHFHLYLQJHPDLO
Your HP Jornada includes Inbox, a full-featured e-mail program that is part of
Microsoft Pocket Outlook. You can use Inbox to send and receive e-mail
messages either by synchronizing messages with Microsoft Exchange or
Microsoft Outlook on your desktop PC, or by connecting directly to an e-mail
server through an ISP or a network.
Page 60
56 | HP Jornada 520 Series User’s Guide
6HQGLQJDQGUHFHLYLQJPHVVDJHVYLD\RXUGHVNWRS3&
You can send and receive messages on your HP Jornada via the e-mail
service on your desktop PC by synchronizing your Inbox. When you enable
Inbox synchronization in ActiveSync options, messages are transferred from
the Inbox and Outbox on your HP Jornada to the corresponding folders on
your desktop PC each time you synchronize.
=XNWJKUN2WKXa\bWLQ[XWRcJ]RXW
1. In ActiveSync on your desktop PC, click
When you synchronize
•
•
You can only synchronize e-mail messages with a single desktop PC. If you
have established partnerships between your HP Jornada and two desktop
PCs, you can synchronize your Inbox with only one of them.
and then select the Inbox information type.
E-mail messages in the Inbox folder of desktop versions of Microsoft
Exchange or Outlook are copied to the Inbox folder on your HP Jornada.
The e-mail messages on the two computers are linked, so when you
delete an e-mail message on your HP Jornada, it will be deleted from your
desktop PC the next time you synchronize.
E-mail messages in the Outbox folder on your device are transferred to
the Outbox in Microsoft Exchange or Outlook on your desktop PC. The
messages are sent the next time you send mail from your desktop PC.
Options
on the
Tools
menu,
6HQGLQJDQGUHFHLYLQJPHVVDJHVZLWK,QER[
If you have an e-mail account with an ISP or on a corporate network, you can
connect to the e-mail server for that account with a modem or network card,
and then use Inbox to send and receive e-mail messages directly.
When you connect to the e-mail server, new messages are downloaded to the
Inbox folder on your HP Jornada, messages in your Outbox folder are sent,
and messages that have been deleted on the e-mail server are deleted from
the Inbox folder.
Messages that you receive directly from an e-mail server (rather than from
your desktop PC) remain linked to the e-mail server. If you delete a message
on your HP Jornada, the message will be deleted from the e-mail server the
next time you connect.
Page 61
Chapter 4 | Connecting to the Internet | 57
You can work with e-mail messages online or offline. When working online,
you read and respond to messages while connected to the e-mail server.
Messages are sent as soon as you tap
device.
When working offline, you can disconnect from the e-mail server, review the
message headers or messages that you downloaded, and then decide which
messages you want to download completely. The next time you connect,
Inbox downloads the complete messages you have marked for retrieval and
sends the messages you have composed. Working offline reduces the time
you are connected and can save money, especially if you are dialing long
distance.
To retrieve messages from an e-mail account, you must set up a service for
that account. The service includes your account information, message delivery
options, and a link to a dial-up or network connection.
, which saves space on your
Send
=XL[NJ]NJWNVJRU\N[_RLN
1. On the
2. On the
3. Select a service type (IMAP4 or POP3) and type a name for the
service. The name can be anything you choose. If you are not sure
what type of service is associated with your account, consult your
account administrator. Tap
4. If you connect to your mail server using a modem, select a dial-up
connection from the drop-down list.
–or–
If you connect to your mail server over a network connection, select
Network Connection
–or–
Select
for this service. For more information on creating a dial-up
connection, see “Creating an ISP or network connection” earlier in
this chapter.
5. Type the name of your e-mail server, your e-mail user name, and
your password.
6. Enter the domain (if required for Windows NT networking), the
address of your outgoing (SMTP) mail server, and the return address
for replies to your messages. Tap
7. Set message delivery options for your service, and then tap
To connect to your e-mail server from within Inbox, select the appropriate
service on the
Connect
on the
menu, tap
Start
Services
Create new connection
Services
menu, and then tap the Connect button (or tap
Services
Programs
menu, tap
from the drop-down list.
menu).
, and then tap the Inbox icon.
Next
.
.
New Service
Next.
to create a new dial-up connection
Finish
.
Page 62
58 | HP Jornada 520 Series User’s Guide
:RUNLQJZLWKPHVVDJHVRQ\RXU+3-RUQDGD
>\RWP]QNVN\\JPNUR\]
Messages you receive are displayed in the message list. By default, the most
recently received messages appear first in the list. Unread messages are
displayed in bold.
The Inbox message list
=X[NJMJVN\\JPN
1. In the message list, tap the icon of the message you want to read.
To reply to or forward the message, tap
•
To read the next message, tap the down arrow on the Command
•
bar.
.
Page 63
Chapter 4 | Connecting to the Internet | 59
To delete a message, tap
•
messages on your e-mail server or desktop PC, they will be
stored in the Deleted (local) folder. If your messages were
downloaded directly from an e-mail server, they will be deleted
from both your HP Jornada and the e-mail server.
The Read Message Command bar
By default, Inbox downloads only the first 100 lines of each new message
when you connect to your e-mail server or synchronize with your desktop PC.
No e-mail attachments are downloaded. The original messages remain on the
e-mail server or your desktop PC. If you want to read the full message with
attachments, you must mark the message in Inbox, and then connect to the
mail server or synchronize again.
. If your messages are still linked to
=XVJ[TJVN\\JPNOX[[N][RN_JU
1. In the message list, tap and hold the message you want to retrieve.
2. On the pop-up menu, tap
You specify your downloading preferences when you set up the service or
select your synchronization options. You can change them at any time:
Change options for Inbox synchronization using ActiveSync options. For
•
more information, see ActiveSync Help.
Change options for direct e-mail server connections in Inbox on your HP
•
Jornada. On the
service you want to change.
Tools
Get Full Copy
menu, tap
Options
,XVYX\RWPNVJRUVN\\JPN\
.
. On the
Services
tab, tap the
=XLXVYX\NJWNVJRUVN\\JPN
1. Tap
2. In the
Contact list by tapping the Address Book button on the Command
bar.
.
New
box, enter an e-mail address or select a name from the
To
Page 64
60 | HP Jornada 520 Series User’s Guide
3. Comp ose your message.
4. To attach a file, tap the attachment icon.
When you send a file as an attachment, be sure the message recipient can
read the type of file you are sending. If the recipient does not have a Windowspowered Pocket PC, be sure you save the file in an alternative format.
5. Tap
The message is placed in the Outbox folder on your device and will be
delivered the next time you connect to your e-mail server or synchronize
messages with your desktop PC.
when you have finished the message.
Send
6JWJPRWPNVJRUVN\\JPN\JWMOXUMN[\
By default, messages are displayed in one of four folders for each service you
have created: Inbox, Deleted (local), Outbox, and Sent. The Deleted (local)
folder contains messages that have been deleted on your HP Jornada, but are
still linked to messages on your e-mail server or desktop PC.
If you are using IMAP4, you may see a Deleted Items folder. This folder is for
messages deleted on the e-mail server.
The behavior of the Deleted (local) and Sent folders depends on the options
you have chosen. In the message list, tap
Message
If you want to organize messages into additional folders, tap
New Folder
folder, tap and hold the message in the message list, and then tap
Copy to
Moving an e-mail message into a folder you create breaks the link between
the messages on your HP Jornada and the copy on your desktop PC or POP3
e-mail server. The next time you synchronize, the message may be deleted
from the Inbox folder on the mail server or desktop PC. This prevents you from
storing duplicate copies of an e-mail message, but it also means that you will
no longer have access to the e-mail messages you moved out of Inbox except
from your HP Jornada. If you have an e-mail account on an IMAP4 mail
server, the folders you create and the messages you move will be duplicated
on the e-mail server.
tab, select your options.
to create new folders. To move or copy a message to another
on the pop-up menu.
Tools
and then
Options
Tools
. On the
, and then
Move to
or
Page 65
_&RQILJXULQJ\RXU
+3-RUQDGD
This chapter details ways you can optimize your HP Jornada using settings
and the HP applications, and describes ways you can expand the features and
functionality by adding programs. This chapter also offers important tips on
safeguarding your data by managing power and memory and usi ng the
security settings.
| 61
In this chapter, you will learn to
Manage power effectively.
•
Manage the memory on your HP Jornada.
•
Adjust settings for the display and sounds.
•
Use security features to protect your data.
•
Configure hardware buttons for games.
•
Configure menus for easy access to programs and documents.
•
Add or remove programs.
•
Page 66
62 | HP Jornada 520 Series User’s Guide
0DQDJLQJSRZHU
Because the data and files you save on your HP Jornada are stored in RA M,
maintaining a continuous power supply to the HP Jornada at all times is
extremely important. If your HP Jornada runs out of power, all information you
have entered is lost. Although the Windows for Pocket PC operating system
and programs cannot be erased, any custom settings and programs you have
added are erased if you lose power.
Under typical usage conditions, your HP Jornada should operate for approximately 8 hours between charges. Some functions, such as listening to music
or using CompactFlash cards, use considerable power and may reduce this
time significantly.
You should respond as soon as possible when your HP Jornada displays a
dialog box warning of low power. If you continue to use your HP Jornada until
power reaches a critical low condition, a
and the device shuts down automatically. You will be unable to use your
Pocket PC until you connect to external power for charging. Data will be
retained for up to 5 days.
Because your HP Jornada is charged automatically whenever it is connected
to ac power, simply connect the HP Jornada to ac power to recharge when the
power is low. While your HP Jornada is connected to ac power, the
Notification LED indicates the charging status:
Amber indicates that the battery is charging (connected to ac power).
•
Green indicates that the battery is fully charged.
•
Battery very low
message appears,
=XLQNLT]QN[NVJRWRWPYX`N[
1. On the
displayed on a status bar at the bottom of the
Under certain conditions, the power status icon is displayed on the Command
bar in the Today screen. Simply tap the power status icon to open the Power
control panel.
Follow these tips to ensure the longest use of your HP Jornada between
charges:
Use the Power control panel to set your HP Jornada to turn off after a
•
short period of inactivity.
Use the Backlight control panel to set the backlight to dim after a short
•
period of inactivity.
Start
menu, tap
HP settings
. The remaining power is
Settings
tab.
Page 67
Chapter 5 | Configuring your HP Jornada | 63
If you are playing music or using other functions that do not require the
•
display, turn off the display by pressing and holding the Tasks hot key.
(Turn on the display by pressing the Tasks hot key again or by pressing
the On/Off button.)
0DQDJLQJPHPRU\
The memory on your HP Jornada is allocated between storage memory and
program memory. Windows for Pocket PC automatically manages the
allocation between storage and program memory; however, in some situations
(such as when memory is low), it may not be able to automatically adjust the
allocation. If you receive a message stating that storage or program memory is
unavailable, try the following solutions.
,QFUHDVLQJVWRUDJHPHPRU\
You can try any or all of these solutions to increase storage memory:
Buy an optional Type I CompactFlash memory card, and move files from
•
internal memory to the card. (For more information on CompactFlash
cards, see “CompactFlash cards” in chapter 8.)
Delete unnecessary files.
•
Remove Web pages stored for offline viewing in Internet Explorer folders.
•
Remove programs you no longer use. See “Adding or removing
•
programs” later in this chapter.
Clear program memory. See “Increasing program memory,” below.
•
,QFUHDVLQJSURJUDPPHPRU\
You can try any or all of these solutions to increase program memory:
Use HP task switcher or the Memory control panel to stop programs you
•
are not currently using. In most cases, programs automatically stop to free
needed memory. However, in some situations, such as when a dialog box
is waiting for a response, the program may not be able to stop
automatically.
Clear storage memory as described in the preceding section. This will free
•
some storage memory so that it can be reallocated as program memory.
Disconnect the sync cable or remove your HP Jornada from the cradle,
•
remove the CompactFlash card (if installed), and reset your HP Jornada.
See “Resetting your HP Jornada” in chapter 9.
Page 68
64 | HP Jornada 520 Series User’s Guide
=X^\N]QN6NVX[bLXW][XUYJWNU]X\]XYY[XP[JV\
1. Open the Memory control panel, and then tap the
Programs
2. Select a program in the list, and then tap
tab.
Stop
Running
.
=X^\N19]J\T\`R]LQN[]X\]XYY[XP[JV\
1. In the Today screen, tap the HP task switcher icon.
2. On the pop-up menu, tap
Close Window
and then tap
Close All
.
$GMXVWLQJVHWWLQJV
Use the HP settings application to quickly change settings such as screen
brightness and contrast and speaker volume, to display system information
such as memory status and remaining power, and to change display, button,
and power driver settings.
=X\]J[]19\N]]RWP\
1. On the
–or–
Press and hold the HP home menu hot key.
7KH6HWWLQJVWDE
On the
Settings
the speaker volume to suit your work environment, and check the remaining
power. You can also mute the speaker by selecting the speaker mute check
box.
menu, tap
Start
tab you can adjust the screen brightness and contrast, adjust
HP settings
.
Page 69
HP settings
Chapter 5 | Configuring your HP Jornada | 65
To change the speaker volume settings, you can quickly switch to the Sounds
& Reminders control panel by tapping the Speaker button.
Save your preferred settings to any of the four profiles. Select the profile you
want to change, and then adjust the sliders to fine-tune the settings.
The remaining power is displayed on a status bar at the bottom of the
Settings
the power status bar.
tab. To switch to the Power control panel, tap the battery icon next to
7KH0HPRU\WDE
The
Memory
Storage Card memory. For information on allocating memory between storage
and programs, see “Managing memory” earlier in this chapter.
tab displays total and available (free) Storage, Program, and
7KH3UHIHUHQFHVWDE
Use the
options.
Preferences
tab to customize button settings and certain power
Page 70
66 | HP Jornada 520 Series User’s Guide
To prevent inadvertently turning on your Pocket PC, you can disable the
Record button. On the
check box.
You can also set your Pocket PC to turn on when you press one of the HP hot
keys. On the
default, the HP hot keys are disabled to prevent you from inadvertently turning
on your Pocket PC.)
You can set your Pocket PC to turn on whenever you tap the touch screen. On
the
Preferences
Preferences
Preferences
tab, clear the
tab, select the
tab, select the
Disable HP hot keys
Tap screen to power on
Disable record button
check box. (By
check box.
6HFXULW\
This section provides some tips to safeguard your HP Jornada and the data it
holds from theft or loss. You can set a password to protect your data and keep
a record of when someone tries to access data on your HP Jornada.
6HWWLQJDSDVVZRUG
Use the HP security application to prevent unauthorized access to your HP
Jornada and the data it holds. You can set a password to protect your data,
set a reminder password, and keep a record of when anyone attempts to
access data on your HP Jornada.
If you enable password protection, you must enter your password each time
you turn on your Pocket PC. Or, you can set a short delay, so you do not need
to re-enter your password if you turn on your HP Jornada within a short period
of time. The delay feature can be convenient if you frequently turn your HP
Jornada on and off to conserve power.
=X\N]JY[RVJ[bYJ\\`X[M
1. On the
the HP security icon.
2. On the
onscreen keypad.
3. Select the
menu, tap
Start
Primary
tab, enter a four-digit password by tapping the
Enable password protection
Settings
, and then on the
check box.
Personal
tab, tap
If you forget your password, you must restore your HP Jornada to the factory
default settings. This will erase all data you have stored on your HP Jornada.
For more information, see “Resetting your HP Jornada” in chapter 9.
Page 71
Chapter 5 | Configuring your HP Jornada | 67
=XL[NJ]NJWMNWJKUNJ[NVRWMN[YJ\\`X[M
1. On the
the HP security icon.
2. On the
Question
3. In the
4. Select the
5. In the
your primary password before HP security prompts you with the
question for your reminder password.
When you tap OK, your changes are saved and password protection is
enabled. You must enter the password each time you start your HP Jornada
and each time you open the HP security application.
menu, tap
Start
Reminder
box.
Answer
Prompt after
box, enter the answer to your reminder question.
Enable reminder password
Settings
tab, use the Input panel to enter a question in the
box, enter the number of times you want to try
, and then on the
check box.
Personal
tab, tap
=X\N]JYJ\\`X[MMNUJb
1. Set your primary password.
2. Select the
3. Using the input panel, enter a number of minutes for the delay.
Delay activation after suspend for
check box.
=XLUNJ[bX^[YJ\\`X[M
1. On the
Primary
tab, tap CLR on the numeric keypad.
&UHDWLQJDVHFXULW\ORJ
You can also use the HP security application to record all attempts to access
your HP Jornada, and any attempts to modify the password settings. You can
view the log on your HP Jornada or export it as a file to save or edit on your
desktop PC.
=XNWJKUN\NL^[R]bUXPPRWP
1. On the
Entries appear in the table on the
•
To clear all entries, tap
•
To export the log to a file, tap
•
tab, select the
Log
Enable logging
Log
Clear Log
.
Export Log
check box.
tab.
.
$GGLQJRZQHULQIRUPDWLRQ
If you lose your HP Jornada, owner information can provide an easy way for
someone to identify you as the owner and to return your Pocket PC. Use the
Owner Information control panel to enter or update this information.
Page 72
68 | HP Jornada 520 Series User’s Guide
=XJMMX[LQJWPNX`WN[RWOX[VJ]RXW
1. On the
icon.
2. On the
information.
3. On the
example, a temporary address, or an offer of a reward for the safe
return of your HP Jornada).
menu, tap
Start
Identification
tab, type any other information you want displayed (for
Notes
Settings
tab, enter, your name, address, and/or other
, and then tap the Owner Information
To display your owner information each time you turn on your HP Jornada,
select the
Show information when device is turned on
check box.
&RQILJXULQJKDUGZDUHEXWWRQV
You can configure the hardware buttons on your HP Jornada to suit the way
you work. Individual buttons can be assigned to different programs using the
Buttons control panel, and the HP game buttons application enables yo u to
create hardware profiles for specific games.
7KH%XWWRQVFRQWUROSDQHO
Use the Buttons control panel to assign any of the HP Jornada hardware
buttons—the HP hot keys and the Record button—to any program. You can
also customize the Action button to control the speed at which you scroll
through documents.
=XJ\\RPWJY[XP[JV]XJQJ[M`J[NK^]]XW
1. On the
2. On the
3. In the
to the button.
=XLXW][XU]QN\L[XUU\YNNM
1. On the
2. On the
and the delay before repeat.
menu, tap
Start
Program Buttons
Button assignment
menu, tap
Start
Up/Down Control
Settings
Settings
, and then tap the Buttons icon.
tab, select a button from the list.
list, select the program you want to assign
, and then tap the Buttons icon.
tab, move the sliders to set the repeat rate
Page 73
Chapter 5 | Configuring your HP Jornada | 69
+3JDPHEXWWRQV
The HP game buttons application makes it easier to enjoy your favorite games
on your HP Jornada. Use HP game buttons to assign game actions to the
hardware buttons of your Pocket PC.
=X\]J[]19PJVNK^]]XW\
1. On the
2. Tap the
3. Select the
buttons.
4. In the drop-down list, select a game profile to use or modify, or create
To make it easy to enable or disable the game buttons, select the
status icon
Command bar of the Today screen. Simply tap the status icon to enable or
disable the gaming buttons.
a new game profile.
check box. The HP game buttons status icon will appear in the
,[NJ]RWPJPJVNY[XORUN
You can create a different profile for each of your favorite games by assigning
the hardware buttons on your Pocket PC to the actions associated with each
game.
menu, tap
Start
System
tab, and then tap the HP game buttons icon.
Enable mapping
Settings
.
check box to activate the gaming
Show
=XL[NJ]NJPJVNY[XORUN
1. Start the HP game buttons application.
2. Tap the drop-down list of game profiles. The Input panel appears.
3. Using the Input panel, enter a name for the profile.
4. In the settings list, select an action, and then press the hardware
button you want to assign to the action.
5. Repeat step 4 until you have assigned all the important game actions
to hardware buttons.
Page 74
70 | HP Jornada 520 Series User’s Guide
&RQILJXULQJPHQXV
You can customize the menus on your device to ensure you have easy access
to programs or documents.
+3KRPHPHQX
Use the HP home menu application to quickly launch your favorite programs
or open frequently used documents. You can modify each of the 21 buttons on
the HP home menu by adding descriptions or by assigning them to the
programs or documents you use most.
=XVXMRObJK^]]XWJ\\RPWVNW]
1. Press the HP home menu hot key to open HP home menu. To
display the second page of buttons, press the hot key a second time,
or tap the HP home menu icon in the lower-right corner of the HP
home menu screen.
2. Tap and hold the stylus on the button you want to modify.
3. On the pop-up menu, tap
Assign—Tap
•
document you want to assign to the button.
Rename—Tap
•
displayed under the button. The description can be up to 10
characters long. The default description is the file name.
Delete—Tap
•
Assign, Rename
, and then browse to select the program or
Assign
Rename
Delete
, and then type a description to be
to clear the current button assignment.
, or
Delete
.
Page 75
The HP home menu screen
Chapter 5 | Configuring your HP Jornada | 71
6WDUWPHQX
You can also add or remove programs from the
to access the programs you use most.
=XJMMJY[XP[JV]X]QN<]J[]VNW^
1. On the
2. On the
The
on your HP Jornada. If you do not see a particular program listed, use File
Explorer to move the program to the Start Menu folder.
want to add.
Start Menu
menu, tap
Start
Start Menu
tab displays only the programs stored in the Start Menu folder
Settings
tab, select the check box for the program you
, and then tap
menu to make it easier
Start
.
Menus
1HZPHQX
You can also add or remove programs from the
create documents in common programs.
menu to make it easier to
New
Page 76
72 | HP Jornada 520 Series User’s Guide
=XJMMJMXL^VNW]]X]QNVNW^
1. On the
2. On the
box, and then select the document types you want to appear on the
menu.
menu, tap
Start
New Menu
Settings
tab, select the
, and then tap
Turn on New button menu
Menus
.
check
$GGLQJRUUHPRYLQJSURJUDPV
,QVWDOOLQJSURJUDPV
You can add even more functionality to your HP Jornada by installing
additional software and programs. A wide variety of software is available for
Windows for Pocket PC, ranging from custom business applications and
system utilities to games and entertainment. Some programs are available on
the CD-ROMs included with your HP Jornada. Other programs are available
from software vendors or on the Web.
The only programs that will run on your HP Jornada are those designed
specifically to run on Windows for Pocket PC. You cannot run programs
designed for Windows 95, 98, 2000, Me, or NT on your HP Jornada. In
addition, you may need a version of the program designed specifically for the
SH3 processor.
Install software to your HP Jornada by first loading the installation files onto
your desktop PC, and then using ActiveSync or running the Application
Manager.
=XRW\]JUUY[XP[JV\
1. Download the software program or installer from the Web to your
desktop PC.
–or–
Insert the floppy disk or compact disk into the appropriate drive on
your desktop PC.
2. Connect your HP Jornada to your desktop PC.
3. If the program includes an installer program (typically named
Setup.exe or Install.exe), double-click the installer program on the
desktop PC. The installer program copies the necessary files to the
HP Jornada.
Page 77
Chapter 5 | Configuring your HP Jornada | 73
If the program does not have an associated installer or setup program, drag
the program file (typically an *.exe file type) to the HP Jornada icon in the
ActiveSync window. If the
to copy the file without conversion. Software installed in this way may not
OK
appear on the
program manually if you wish to remove it from the HP Jornada.
Remove Programs
No Converter Selected
list, and you may have to delete the
dialog box appears, tap
=XJMMY[XP[JV\`R]Q*YYURLJ]RXW6JWJPN[
1. Connect the HP Jornada to your desktop PC, and then open the
ActiveSync window.
2. On the
Programs
3. Select the check box for the program you want to add.
menu in the ActiveSync window, click
Tools
.
Add/Remove
5HPRYLQJSURJUDPV
To free storage memory on your HP Jornada, you can remove programs you
no longer use. Only programs you have added can be removed; that is, only
programs that are stored in RAM. The preinstalled programs—programs
stored in ROM—cannot be removed; however, these programs do not use
storage memory.
=X[NVX_NJY[XP[JV
1. On the
2. On the
3. Select the program in the list, and then tap
menu, tap
Start
System
tab, tap
Settings
Remove Programs
.
.
Remove
.
If the program does not appear in the list of installed programs, use File
Explorer on your device to locate the program, tap and hold the program, and
then tap
on the pop-up menu.
Delete
Page 78
74 | HP Jornada 520 Series User’s Guide
Page 79
_0LFURVRIW3RFNHW2XWORRN
Microsoft Pocket Outlook includes Calendar, Contacts, Tasks, Inbox, and
Notes. You can use these programs individually or together. For example,
e-mail addresses stored in Contacts can be used to address e-mail messages
in Inbox.
Using ActiveSync, you can synchronize information in Microsoft Outlook or
Microsoft Exchange on your desktop PC with information in Pocket Outlook on
your HP Jornada. Each time you synchronize, ActiveSync compares the
changes you made on your device and desktop PC and updates both
computers with the latest information. For information on using ActiveSync,
see ActiveSync Help on your desktop PC.
In this chapter, you will learn to
Schedule appointments and meetings using Calendar.
•
Keep track of friends and colleagues using Contacts.
•
Keep a to-do list in Tasks.
•
Capture thoughts and ideas with Notes.
•
| 75
Page 80
76 | HP Jornada 520 Series User’s Guide
&DOHQGDUVFKHGXOLQJDSSRLQWPHQWVDQGPHHWLQJV
Use Calendar to schedule appointments, including meetings and other events.
You can check your appointments in one of several views (Agenda, Day,
Week, Month, and Year) and easily switch views by using the
View
menu.
The Day view in Calendar
When you tap an appointment in Calendar, a summary screen of the
information you entered is displayed. Tap the top portion of the summar y
screen to change the appointment information.
You can customize the Calendar display—for example, changing the first day
of the week—by tapping
Options
on the
Tools
menu.
=XL[NJ]NJWJYYXRW]VNW]
1. In Day or Week view, tap the desired date and time for the
appointment.
2. Tap
New
.
Page 81
Chapter 6 | Microsoft Pocket Outlook | 77
3. Using the Input panel, enter a description and a location for the
appointment.
4. If needed, tap the date and time to change them.
5. Enter other desired information. (You may need to hide the Input
panel to see all available fields.)
6. To add notes, tap the
a recording. For more information on creating notes, see “Notes:
capturing thoughts and ideas” later in this chapter.
7. When you are finished, tap OK to return to Calendar.
If you select
according to the options you set in the Sounds & Reminders control panel.
Remind me
in an appointment, your HP Jornada will remind you
tab. You can enter text, draw, or create
Notes
&UHDWLQJPHHWLQJUHTXHVWV
You can use Calendar to set up meetings with users of Outlook or Pocket
Outlook. A meeting notice is created automatically and sent either when you
synchronize Inbox or when you connect to your e-mail server. Indicate how
you want meeting requests sent by tapping
send and receive e-mail messages through ActiveSync, select
=X\LQNM^UNJVNN]RWP
1. Create an appointment.
2. In the appointment details, hide the Input panel, and then tap
Attendees
3. From the list of e-mail addresses you have entered in Contacts,
select the meeting attendees.
The meeting notice is created automatically and placed in the Outbox folder.
For more information on sending and receiving meeting requests, see
Calendar Help and Inbox Help on your HP Jornada.
.
Tools
and then
Options
ActiveSync
. If you
.
&RQWDFWVWUDFNLQJIULHQGVDQGFROOHDJXHV
Contacts maintains a list of your friends and colleagues so that you can easily
find the information you are looking for, whether you are at home or on the
road. Using the infrared port on your HP Jornada, you can quickly share
Contacts information with other Windows-powered devices.
Page 82
78 | HP Jornada 520 Series User’s Guide
The Contacts list
When you tap a contact in the Contact list, a summary screen of the
information you have entered is displayed.
To change the way contacts are displayed in the list, tap
Options
.
Tools
=XL[NJ]NJLXW]JL]
1. Tap
2. Using the Input panel, enter a name and other contact information.
You will need to scroll down to see all available fields.
3. To assign the contact to a category, scroll to and then tap
Categories.
can display contacts by category.
4. To add notes, tap the
a recording. For more information on creating notes, see “Notes:
capturing thoughts and ideas” later in this chapter.
5. When finished, tap OK to return to the Contact list.
New
.
Select a category from the list. In the Contact list, you
tab. You can enter text, draw, or create
Notes
and then
Page 83
Chapter 6 | Microsoft Pocket Outlook | 79
7DVNVNHHSLQJDWRGROLVW
Use Tasks to keep track of what you have to do. In the Task list, overdue
tasks are displayed in red. When you tap a task in the Task list, a summary
screen of the information you entered is displayed.
The Task list
To change the way information is displayed in the list, tap
Options
.
=XL[NJ]NJ]J\T
1. Tap
2. Using the Input panel, enter a subject.
3. You can enter a start date and due date or enter other information by
first tapping the field. If the Input panel is open, you will need to hide
it to see all available fields.
New
.
Tools
and then
Page 84
80 | HP Jornada 520 Series User’s Guide
4. To assign the task to a category, tap
category from the list. (In the Task list, you can display tasks by
category.)
5. To add notes, tap the
a recording. For more information on creating notes, see ”Notes:
capturing thoughts and ideas” later in this chapter.
6. When finished, tap OK to return to the Task list.
To quickly create a task with only a subject, tap
Then, tap
Tap here to add a new task
tab. You can enter text, draw, or create
Notes
and enter your task information.
Categories,
Entry Bar
and then select a
on the
Tools
menu.
1RWHVFDSWXULQJWKRXJKWVDQGLGHDV
Quickly capture thoughts, reminders, ideas, drawings, and phone numbers
with Notes. You can create a written note or a recording. You can also include
a recording within a note. If a note is open when you create the recording, it
will be included in the note as an icon. If the note list is displayed, the
recording will be created as a standalone recording.
The Notes list
Page 85
Chapter 6 | Microsoft Pocket Outlook | 81
=XL[NJ]NJWX]N
1. Tap
2. Create your note by writing, drawing, typing, and/or recording. For
more information about using the Input panel, writing and drawing on
the screen, and creating recordings, see “Entering information” in
chapter 2.
New
.
([FKDQJLQJDSSRLQWPHQWVFRQWDFWVWDVNVDQGQRWHV
ZLWKRWKHUGHYLFHV+3LQIRH[FKDQJH
HP info exchange allows you to send and receive PIM data to and from non–
Windows-powered PDA devices (for example, Palm devices) from within
Calendar, Contacts, and Tasks via infrared. You can also receive (but not
send) memos from a PDA device and store them as text files in the My
Documents folder of your HP Jornada.
When you receive an item from a PDA device, it does not matter which Pocket
Outlook application is active when you select
example, you can have Contacts open and still receive a Calendar or Task
item. (HP info exchange is not available in Pocket Outlook Inbox.)
HP info exchange runs only on your HP Jornada. No additional software is
required for IrDA-equipped PDA devices.
Recv(non-Windows)
=X\NWM926RWOX[VJ]RXWO[XVbX^[193X[WJMJ]XJW2[-*NZ^RYYNM
9-*MN_RLN
1. In Contacts, Calendar, Tasks, tap to select the item you want to send.
2. Make sure the PDA device is powered on. Align the infrared port on
your HP Jornada with the infrared port on the receiving device.
3. Tap
The PDA device will receive the transmitted items automatically.
Send(non-Windows)
on your HP Jornada. The HP info exchange Send window will
appear, indicating that your HP Jornada is looking for a receiving
device.
on the
menu of a PIM application
Tools
. For
You cannot send notes from your HP Jornada to a non–Windows-powered
device by infrared.
Page 86
82 | HP Jornada 520 Series User’s Guide
=X[NLNR_N926RWOX[VJ]RXWXWbX^[193X[WJMJO[XVJW2[-*
NZ^RYYNM9-*MN_RLN
1. Set the PDA device to beam selected item(s).
2. Align the infrared port on your HP Jornada with the infrared port on
the sending device.
3. Select
Recv(non-Windows)
on your HP Jornada. The HP info exchange Receive window will
appear indicating that your HP Jornada is looking for a sending
device.
on the
menu of a PIM application
Tools
$ERXWWKHGDWDEHLQJWUDQVIHUUHG
HP info exchange makes it easy to exchange essential information with an
IrDA-equipped PDA device. The data fields of your HP Jornada Contacts,
Calendar, and Tasks applications are mapped to the data fields on the PDA
device to allow capture of important PIM information. However, not all of the
data fields correspond between the two devices, so not all data can be
exchanged. Some notes on the features and characteristics of the field
mappings for exchanged data are listed below:
HP info exchange supports sending and receiving multiple contacts,
•
appointments and tasks.
A number of Pocket Outlook fields are not used (e.g. Children, Spouse),
•
because they are not used by other PDA devices or are not supported by
the v-card standard.
If the number of entries of important field types (e.g. phone numbers)
•
received exceeds the number of Pocket Outlook fields available to store
them, the extra entries will be placed in the Notes section of the item.
For standard Contact fields (which support only single-line text), multiline
•
text on PDA devices is converted into single-line text, and all CR/LF pairs
converted to spaces. All information is retained.
Your HP Jornada treats Business Cards received from a PDA device as
•
contacts.
Contents marked as ”private” in other PDA devices are not sent to your
•
HP Jornada.
Memos received from a PDA device are stored as text files in the My
•
Documents folder of your HP Jornada. The received memos may be
renamed so that no existing memos in your HP Jornada will be
overwritten. (You cannot send a memo from your HP Jornada to a PDA
device.)
Page 87
_&RPSDQLRQSURJUDPV
Your HP Jornada includes Microsoft Windows for Pocket PC, as well as
programs from other vendors. The Pocket PC software includes Microsoft
Pocket Word, Microsoft Pocket Excel, Microsoft Windows Media Player for
Pocket PC, and Microsoft Reader. Third-party programs include OmniSolve
from Landware. This section provides an overview of these programs and
enough information to get you started. For complete instructions on using a
program, refer to online Help for that program.
In this chapter you will learn about
Microsoft Pocket Word
•
Microsoft Pocket Excel
•
Microsoft Windows Media Player for Pocket PC, MusicMatch Jukebox,
•
and Windows Media Manager
Microsoft Reader
•
Landware OmniSolve financial calculator
•
| 83
Page 88
84 | HP Jornada 520 Series User’s Guide
0LFURVRIW3RFNHW:RUG
Microsoft Pocket Word works with Microsoft Word on your desktop PC to give
you easy access to copies of your documents. You can create ne w documents
on your HP Jornada, or you can copy documents from your desktop PC to
your HP Jornada. Synchronize documents between your desktop PC and your
HP Jornada regularly so that you have the most up-to-date content in both
locations.
=X^\N9XLTN]@X[M
1. On the
icon.
2. Tap the name of a document in the file list.
–or–
Tap
To open a template rather than a blank document, select a template for new
documents. On the
default template. When you tap
text and formatting already provided.
You can open only one document at a time; when you open a second
document, you will be asked to save the first. You can save a document you
create or edit in a variety of formats, including Pocket Word (.psw), Rich Text
Format (.rtf), and Plain Text (.txt).
You can enter information in Pocket Word in four modes: writing, drawing,
typing, and recording. Use the
mode has its own toolbar, which you can show and hide by tapping the
Show/Hide Toolbar button on the Command bar.
Typing Mode.
•
with either the soft keyboard or the Character Recognizer. For more
information on entering typed text, see “Entering information” in chapter 2.
Writing Mode.
•
screen. Ruled lines are displayed as a guide, and the zoom magnification
is greater than in typing mode to allow you to write more easily. For more
information on writing and selecting writing, see “Entering information” in
chapter 2.
New
menu, tap
Start
to open a blank document.
Tools
Use the Input panel to enter typed text into the document
In writing mode, use your stylus to write directly on the
Programs
menu, tap
New
View
menu to switch between modes. Each
, and then tap the Pocket Word
Options
, the template appears with appropriate
, and then browse to select the
Written words are converted to graphics (metafiles) when a Pocket Word
document is converted to a Word document on your desktop PC.
Page 89
Chapter 7 | Companion programs | 85
• Drawing mode.
Gridlines appear as a guide. When you lift your stylus off the screen after
the first stroke, you will see a drawing box indicating the boundaries of the
drawing. Every subsequent stroke within or touching the drawing box
becomes part of the drawing. For more information on drawing and
selecting drawings, see “Entering information” in chapter 2.
• Recording mode.
document. Recordings are saved as .wav files. For more information on
recording, see “Entering information” in chapter 2.
In drawing mode, use your stylus to draw on the screen.
Use recording mode to embed a recording into your
7LSVIRUZRUNLQJLQ3RFNHW:RUG
You can change the zoom magnification by tapping
•
Then select the percentage you want. Select a higher percentage to enter
text and a lower one to see more of your document.
If you are opening a Word document created on a desktop PC, select
•
Wrap to Window
document.
on the
menu so that you can see the entire
View
View
and then
Zoom
0LFURVRIW3RFNHW([FHO
Microsoft Pocket Excel works with Microsoft Excel on your desktop PC to give
you easy access to copies of your workbooks. You can create new workbooks
on your device, or you can copy workbooks from your desktop PC to your
device. Synchronize workbooks between your desktop PC and your device so
that you have the most up-to-date content in both locations. Pocket Excel
provides fundamental spreadsheet tools, such as formulas, functions, sorting,
and filtering, which enable you to create simple workbooks such as expense
reports and mileage logs.
.
=X^\N9XLTN].aLNU
1. On the
icon.
2. Tap the name of a workbook in the file list.
–or–
Tap
To open a template rather than a blank workbook, select a template for new
workbooks. On the
default template. When you tap
text and formatting already provided.
New
menu, tap
Start
to open a blank workbook.
Tools
Programs
menu, tap
New
Options
, the template appears with appropriate
, and then tap the Pocket Excel
, and then browse to select the
Page 90
86 | HP Jornada 520 Series User’s Guide
You can open only one workbook at a time; when you open a second
workbook, you will be asked to save the first. You can save a workbook you
create or edit in a variety of formats, including Pocket Excel (.pxl) and Excel
(.xls).
7LSVIRUZRUNLQJLQ3RFNHW([FHO
Use full-screen mode to see as much of your worksheet as possible. Tap
•
and then
View
If your workbook contains sensitive information, you can protect it with a
•
password. To do so, open the workbook, tap
Show and hide window elements. Tap
•
you want to show or hide.
Freeze panes on a worksheet. First select the cell where you want to
•
freeze panes. Tap
freeze the top and leftmost panes in a worksheet to keep row and column
labels visible as you scroll through a sheet.
Split panes to view different areas of a large worksheet. Tap
•
then
Split
split, tap
Show and hide rows and columns. To hide a row or column, select a cell
•
in the row or column you want to hide. Then tap
Column
then
Go To,
column. Then tap
Full Screen
View
. Then drag the split bar to where you want it. To remove the
and then
View
, and then
Hide
and then type a reference that is in the hidden row or
Format
. To exit full-screen mode, tap
, and then
Edit
and then tap the elements
View
and then
Remove Split
. To show a hidden row or column, tap
, then
Freeze Panes
.
or
Row
Column
. You might want to
Format
, and then
Restore
Password
View
, then
Unhide
Row
Tools
.
.
and
or
,
.
0LFURVRIW:LQGRZV0HGLD3OD\HU
Use Microsoft Windows Media Player for Pocket PC to listen to digital audio
files, such as songs or sound clips. Media Player supports sound files
recorded in the following formats: WMA, MP3, and WAV.
=X\`R]LQ]X@RWMX`\6NMRJ9UJbN[
1. On the
Player icon.
Start
menu, tap
Programs,
and then tap the Windows Media
Page 91
The Windows Media Player Welcome screen
Chapter 7 | Companion programs | 87
To save power, turn off the display while listening to music on your HP
Jornada. Press and hold the Tasks hot key to turn the display off (without
turning off the device). Press the Tasks hot key (when device is off) to turn the
display on again.
&UHDWLQJDXGLRILOHVIRU\RXU+3-RUQDGD
You can copy music files to enjoy on your HP Jornada by converting or
“ripping” files from your favorite audio CDs or by downloading songs from a
Web site such as EMusic.com. When you have saved the audio file on your
desktop PC, use the Microsoft Windows Media Manager for Pocket PC to
convert the file to the appropriate format and copy it to your HP Jornada.
,XYbRWP\XWP\O[XVJ^MRX,-\
Use the MusicMatch Jukebox application to record songs from your favorite
audio CDs in a format that can be played on your HP Jornada. MusicMatch
Jukebox is included on the HP Jornada CD-ROM.
Page 92
88 | HP Jornada 520 Series User’s Guide
=XLXYbJ\XWPO[XVJWJ^MRX,-
1. Install MusicMatch Jukebox from the HP Jornada CD-ROM onto your
desktop PC. For more information, refer to the HP Jornada CD-ROM.
2. On your desktop PC, start the Jukebox program.
3. Insert an audio CD into the CD-ROM drive on your desktop PC.
Jukebox should automatically detect the audio CD.
4. In the Jukebox window, select the song that you want to copy.
5. Enter the name of the song, the album title, and the artist’s name.
6. Click the Play button (triangular arrow) to begin copying.
7. To specify the location of the song file, click
Options
menu, click
Settings
, and then select a folder.
Recorder
>\RWP6RL[X\XO]@RWMX`\6NMRJ6JWJPN[OX[9XLTN]9,
Use Microsoft Windows Media Manager for Pocket PC on your desktop PC to
create digital audio files in Windows Media format and to transfer audio files to
your HP Jornada. Files saved in Windows Media use very little storage
memory compared to some other recording formats.
Windows Media Manager is included in the Extras folder on the ActiveSync
CD-ROM. You must install Windows Media Manager on your desktop PC to
copy and convert digital audio files.
Some vendors distribute audio files as “packaged content”; that is, digital
music that has been encrypted to protect the copyright. You must have a valid
license to play packaged content on your HP Jornada. For more informati on
about obtaining a license and specific license terms, read the license
agreement provided by the file vendor.
on the
8VLQJWKH3OD\OLVW0DQDJHU
Use the Playlist Manager to set the track playback order.
default playlist. It contains all digital audio files available for playback on your
HP Jornada (including those stored on a CompactFlash card, if one is
installed). To see a list of recently selected playlists, tap
create or edit playlists, tap
Tap and hold a track or playlist to perform actions such as copying, moving,
and deleting.
All Playlists
.
All My Music
Select Playlist
is the
. To
Page 93
Chapter 7 | Companion programs | 89
:RUNLQJZLWKDXGLRILOHVRQD&RPSDFW)ODVK&DUG
Because songs and audio files can use a lot of storage memory, you might
want to store them on a Type I CompactFlash card. When you store songs
and audio files on a Type I CompactFlash card, the files must be stored in a
folder named My Documents. In addition, it is recommended that you use
Microsoft Windows Media Manager for Pocket PC to transfer files from your
desktop PC to the storage card, because Media Manager can automatically
resolve security protocols for packaged content. For more information on
installing a CompactFlash card and working with files on a storage card, see
“CompactFlash cards” in chapter 8.
When you store songs and audio files on a CompactFlash card, the files must
be stored in a folder named My Documents.
0LFURVRIW5HDGHU
Use Microsoft Reader to read electronic books (eBooks) on your HP Jornada.
Download books to your desktop PC from eBook Web sites. Then, use
ActiveSync to copy the book files to your Pocket PC. The books appear in the
Reader Library.
An eBook includes many features not available with a paper book. These
features are available from any book page. You can add notes or bookmar ks,
highlight text, search for words or phrases, and copy text to use in other
documents or messages.
The Reader Guidebook is preinstalled on your HP Jornada, and contains all
the information you will need to use Microsoft Reader. Open the Guidebook
from within Microsoft Reader, as described below.
=X\]J[]6RL[X\XO];NJMN[
1. On the
Microsoft Reader displays the Library, a list of all the eBooks stored
on your HP Jornada.
2. To open a book, tap the title in the Library list.
The MSReader folder in the Extras folder on the ActiveSync CD-ROM
contains sample books and a dictionary. Use ActiveSync to download the files
from your desktop PC to your device as described in the Readme file in the
MSReader folder.
Start
menu, tap
Programs,
and then tap
Microsoft Reader
.
Page 94
90 | HP Jornada 520 Series User’s Guide
When you have finished reading a book, you may want to delete it to conserve
space on your device. If a copy of the book is stored on your desktop PC, you
can download it again at any time. To remove a book from your device, tap
and hold the title in the Library list and then tap
on the pop-up menu.
Delete
2PQL6ROYH
OmniSolve is a financial application that is designed specifically for real estate,
retail, and business professionals who use Pocket PCs to make financial
decisions quickly and accurately. OmniSolve employs a form-filling metaphor
to provide a rich problem-solving environment that is unparalleled in eas e of
use, power, and flexibility.
=X\]J[]8VWR<XU_N
1. On the
For detailed help and procedures about using OmniSolve, refer to online Help
or see the LandWare Web site at www.landware.com/omnisolve
Start
menu, tap
Programs
, and then tap the OmniSolve icon.
.
For other non-HP Pocket PC software solutions, refer to the HP Jornada CDROM or visit the HP Jornada Web site at www.hp.com/jornada/solutions
Page 95
_$FFHVVRULHV
By purchasing accessories for your HP Jornada, you can add functionalit y,
replace lost parts, and protect your Pocket PC from accidental damage. HP
makes a variety of accessories designed specifically to enhance your HP
Jornada Pocket PC. In addition, you can purchase CompactFlash card
accessories from many vendors. This chapter describes
accessories available from HP
•
how to install and use CompactFlash cards
•
| 91
Page 96
92 | HP Jornada 520 Series User’s Guide
+3EUDQGHGDFFHVVRULHV
The following optional accessories are available from Hewlett-Packard. (HP
item numbers are listed in parentheses.) Check the Hewlett-Packard Web site
at www.hp.com/jornada/accessories
work with all models of the HP Jornada 520 Series Pocket PC.
Serial Cradle (F1834A).
•
communications port on a desktop PC using this desktop cradle.
Serial Cable (F1819A).
•
communications port on a desktop PC.
AC Adapter (F1817A).
•
this worldwide voltage adapter.
Executive Leather Case (F1829A).
•
this slim, executive design leather case with stylus holder. Flip-top design
allows for maximum ergonomic fit and functionality.
Executive Bi-Fold Leather Case (F1826A).
•
with this elegantly designed bifold leather case for classical look and
functionality.
Leather Clip Pouch in Brown (F1887A) or Black (F1886A
•
HP Jornada at your side with a clip-on belt pouch.
Stylus Pens (F1818A).
•
original pens.
Color Cover (F1850A).
•
metal cover with built-in stylus slot.
Screen Protectors (F1827A).
•
and scuffs with a plastic screen protector (pack of six).
Connect to ac power anywhere in the world with
Replace your lost stylus with this pack of three
Protect your HP Jornada in style with a colorful
for updates to this list. These accessories
Connect your HP Jornada to a serial
Connect your HP Jornada to a serial
Protect your HP Jornada in style with
Protect your HP Jornada
). Keep your
Protect your touch screen from scratches
Page 97
Chapter 8 | Accessories | 93
&RPSDFW)ODVKFDUGV
CompactFlash cards provide a wide range of additional functionality, such as
additional memory, removable storage, connection to an external monitor,
connection to a network, and modems.* Many cards have been tested
specifically for use with the HP Jornada. For a list of recommended cards, visit
the HP Web site at www.hp.com/jornada/accessories
Before you can use a particular card, you may need to install the software
driver for that card. The software drivers for the Windows for Pocket PC
operating system should be available from the card’s manufacturer. Install
software drivers as you would install any other software or program. For more
information, see “Adding or removing programs” in chapter 5.
=XRW\]JUUJ,XVYJL]/UJ\QLJ[M
1. Open the door to the CompactFlash slot.
2. Insert the CompactFlash card into the slot.
If you are using a CompactFlash memory card or another card that does not
require a cable, you can close the door to the CompactFlash slot while the
card is installed in your HP Jornada.
If you are using a CompactFlash Card modem or NIC, which requires a cable
connection to the card, the cable connector will protrude from the slot, and you
cannot close the door. Slide the door into the casing of the device parallel to
the CompactFlash card until it is recessed inside your HP Jornada.
.
* Modem must be purchased separately. Some Web sites/content may not be available.
Page 98
94 | HP Jornada 520 Series User’s Guide
The Type I CompactFlash card slot.
Page 99
_7URXEOHVKRRWLQJ
If you encounter difficulty while using your HP Jornada Pocket PC, this chapter
will help you find answers. If you need information about troubleshooting
ActiveSync, click
ActiveSync.
The information in this chapter will help you
Reset your HP Jornada.
•
Restore your HP Jornada to the factory default settings.
•
Troubleshoot basic problems.
•
Troubleshoot problems with remote connections.
•
Troubleshoot problems with the display and touch screen.
•
Microsoft ActiveSync Help
on the
Help
menu in
| 95
Page 100
96 | HP Jornada 520 Series User’s Guide
5HVHWWLQJ\RXU+3-RUQDGD
Occasionally, you may need to reset your HP Jornada; for example, you ma y
reset after you restore data from your desktop PC or when the operating
system stops responding. Resetting your HP Jornada is similar to restarting
your desktop PC. It restarts the operating system and preserves any saved
data, but you will lose any unsaved data. Some user-configurable HP settings
may not be saved when you reset your HP Jornada.
Reset after restoring data from a backup file or when the HP Jornada appears
to be “frozen” or “locked up.”
When you reset, you lose un saved data in all open do cuments or programs. Use
HP task switcher to close all open documents and programs. (In the Today
screen, tap the HP task switcher icon, and then tap
on the pop-up menu.)
All
Close Window
and
=X[N\N]
1. Disconnect the sync cable or remove your HP Jornada from the serial
cradle.*
2. Remove the CompactFlash card (if installed).
3. Use the stylus to press the Reset button on the back of the HP
Jornada, as shown in the following illustration.
Close
* Serial cradle can be purchased as an optional accessory.
Loading...