Hoover HOE3184IN User Manual

• HOT3160B E0

• HOT3161BI WIFI

USER INSTRUCTIONS

OVENS

• HOAZ7150IN WIFI

• HOT3161WI WIFI

• HOE3031IN WIFI

• HOE3184IN WIFI

• HOE3174IN WIFI

• HOZ3150IN WIFI

KULLANIM KILAVUZU

FIRINLAR

NOTICE D'EMPLOI ET D'INSTALLATION

DES FOURS ENCASTRABLES

MANUALE D’ISTRUZIONI

FORNO

INSTRUCCIONES DE USO

HORNOS EMPOTRABLES

PIEKARNIKI DO ZABUDOWY

INSTRUKJA OBS UGIŁ

FORNOS

MANUAL DE INSTRUÇÕES DE UTILIZAÇÃO

EINBAUBACKKÖFEN

BEDIENUNGSANLEITUNG

OVEN

GEBRUIKSAANWIJZING

POKYNY PRO UŽIVATELE

TROUBY

NAVODILO ZA UPORABO

VEČNAMENSKE VGRADNE PEČICE

ΦΟYPNOI

O H IE XPH HΔΣ ΣΣГ

CANDY HOOVER GROUP S.R.L. • Via Comolli 16 • 20861 Brugherio (MB) - Italy

103

General Warnings

• During cooking, moisture may condense inside the oven cavity or on the glass of the door. This is a normal condition. To reduce this effect, wait 10-15 minutes after turning on the power before putting food inside the oven. In any case, the condensation disappears when the oven reaches the cooking temperature.

• Cook the vegetables in a container with a lid insteadofanopentray.

• Avoid leaving food inside the oven after cooking for more than 15/20 minutes.

• WARNING: the appliance and accessible parts become hot during use. Be careful not to touch any hot parts.

•WARNING: the accessible parts can become hot whentheovenisinuse.Childrenmustbekeptata safe distance.

•WARNING: ensure that the appliance is switched off before replacing the bulb, to avoid the possibility of electricshocks.

•WARNING:before initiating the automatic cleaning cycle:

- Cleanthe oven door;

- Remove large or coarse food residues from the inside of the oven using a damp sponge. Do not use detergents;

- Remove all accessories and the sliding rack kit (where present);

- Donot place tea towels

• In ovens with meat probe it is necessary, before making the cleaning cycle, close the hole with the nut provided. Always close the hole with the nut when themeat probeis not used.

•Children under 8 must be kept at a safe distance from the applianceif not continuously supervised.

•Children must not play with the appliance. The appliance can be used by those aged 8 or over and by those with limited physical, sensorial or mental capacities, without experience or knowledge of the product, only if supervised or provided with instruction as to the operation of the appliance, in a safe way with awareness of the possible risks.

•Cleaning and maintenance should not be carried out byunsupervised children.

•Do not use rough or abrasive materials or sharp metal scrapers to clean the oven door glasses, as they can scratch the surface and cause the glass to shatter.

•The oven must be switched off before removing the removable parts and,after cleaning, reassemble them according the instructions.

•Only use the meat probe recommended for this oven.

•Do not use a steam cleaner for cleaning operations.

EN 02

• Connect a plug to the supply cable that is able to bear the voltage, current and load indicated on the tag and having the earth contact. The socket must be suitable for the load indicated on the tag and must be having the earth contact connected and in operation. The earth conductor is yellow-green in colour. This operation should be carried out by a suitably qualified professional. In case of incompatibility between the socket and the appliance plug, ask a qualified electrician to substitute the socket with another suitable type. The plug and the socket must be conformed to the current norms of the installation country. Connection to the power source can also be made by placing an omnipolar breaker between the appliance and the power source that can bear the maximum connected load and that is in line with current legislation. The yellow-green earth cable should notbe interruptedby the breaker. The socket or omnipolar breaker used for the connection should be easily accessible when the appliance is installed.

•The disconnection may be achieved by having the plug accessible or by incorporating a switch in the fixed wiring in accordance with the wiring rules.

•If the power cable is damaged, it must be substituted with a cable or special bundle available from the manufacturer or by contacting the customer service department.

•The typeof power cable must be H05V2V2-F.

•Failure to comply with the above can compromise the safety of the appliance and invalidate the guarantee.

•Any excess of spilled material should be removed beforecleaning.

•During the pyrolytic cleaning process, surfaces can heat up more than usual, children must therefore be kept ata safe distance.

•The appliance must not be installed behind a decorativedoor in order to avoid overheating.

•When you place the shelf inside, make sure that the stop is directed upwards and in the back of the cavity. The shelf must be inserted completely into the cavity

• WARNING: Do not line the oven walls with aluminum foil or single-use protection available from stores. Aluminum foil or any other protection, in direct contact with the hot enamel, risk melting and deteriorating theenamel of the insides.

• WARNING: Never removethe oven door seal.

• No additional operation/setting is required in order to operate the appliance at the rated frequencies.

Summary

General Instructions

Product Description

Use of the Oven

1.1 Safety indications

1.2 Electrical safety

1.3 Recommendations

1.4 Installation

1.5 Waste management

1.6 Declaration of compliance

2.1 Overview

2.2 Accessories

2.3 First use

3.1 Display description

3.2 Cooking modes

Oven Cleaning and Maintenance

Troubleshooting

4.1 General notes on cleaning

4.2 Hydro Easy Clean Function

4.3 Maintenance

• Removing and cleaning wire racks

• Removal of the oven window

• Removal and cleaning of the glass door

• Changing the bulb

5.1 F.A.Q.

EN 03

1. General Instructions

We thank you for choosing one of our products. For the best results with your oven, you should read this manual carefully andretainitforfuturereference. Before installing theoven, takenoteofthe serial number so that youcangiveitto customerservice staffifanyrepairsarerequired. Having removedthe oven from its packaging, check that it hasnotbeen damaged duringtransportation. Ifyouhavedoubts, do not use the oven and refer to a qualified technician for advice. Keep all of the packaging material (plastic bags, polystyrene, nails)out of thereachofchildren. When the oven isswitchedonforthe first time, strong smelling smoke can develop, which is caused by the glue on the insulation panels surrounding the oven heating for the first time. This is absolutely normal and, if it occurs, you should wait for the smoke to dissipate before putting food in the oven. The manufacturer accepts no responsibilityincaseswheretheinstructionscontainedin thisdocumentarenotobserved.

NOTE: the oven functions, properties and accessories cited inthis manual will vary, depending on the model you havepurchased.

1.1 Safety Indications

Only use the oven for its intended purpose, that is only for the cooking of foods; any other use, for example as a heat source,is considered improper and thereforedangerous. Themanufacturercannot beheldresponsiblefor anydamageresultingfromimproper, incorrector unreasonableusage.

The use of any electrical appliance implies the observance of some fundamentalrules:

1.2 Electrical Safety

ELECTRICAL CONNECTIONS. The power supply to which the oven is connected must conform with the laws in force in the country of installation. The manufacturer accepts no responsibility for any damage caused by the failure to observe these instructions. The oven must be connected to an electrical supply with an earthed wall outlet or a disconnector with multiple poles, depending on the laws in force in the country of installation. The electrical supply should be protected with suitable fuses and the cables used must have a transverse section that can ensurecorrectsupplytotheoven.

CONNECTION

The oven is supplied with a power cable that should only be connected to an electrical supply with 220-240 Vac 50 Hz power between the phases or between the phase and neutral. Before the oven is connected to the electricalsupply, itisimportantto check:

- do not pull on the power cableto disconnecttheplugfromthesocket;

- do not touch the appliance with wet or damp hands or feet;

- in generalthe use of adaptors,multiplesocketsandextensioncablesis not recommended;

- in case of malfunction and/or poor operation,switchofftheapplianceand do not tamper with it.

- powervoltageindicatedon thegauge;ENSURE THAT AN ELECTRICIAN OR QUALIFIED TECHNICIAN MAKES THE

- the setting of the disconnector. The grounding wire connected to the oven's earth terminal must be

connectedtotheearthterminalofthepowersupply.

WARNING

Before connecting theoven to the powersupply, ask aqualified electrician to check the continuity of the power supply's earth terminal. The manufacturer accepts no responsibility for any accidents or other problems caused by failure to connect the oven tothe earthterminal or by an earth connection thathas defectivecontinuity.

NOTE: as the oven could require maintenancework, it is advisable tokeep another wall socket available sothat theoven canbe connected to this if it is removed from the space in which it is installed. The power cable must only be substituted by technical service staff or by technicians with equivalentqualifications.

1.3 Recommendations

After each use of the oven, a minimum of cleaning will help keep the oven perfectly clean.

Do not line the oven walls with aluminium foil or single-use protection available from stores. Aluminium foil or any other protection, in direct contact with the hotenamel, risks melting and deteriorating the enamel of the insides.

In order to prevent excessive dirtying of your oven and the resulting strong smokey smells, werecommendnot usingthe oven at veryhigh temperature. It is better to extend the cooking time and lower the temperature a little. In addition to the accessories supplied with the oven, we advise you only use dishes andbaking mouldsresistant to very high temperatures.

1.4 Installation

The manufacturers have no obligation to carrythis out.If theassistanceof the manufacturer is required to rectify faults arising from incorrect installation, this assistance is not covered by the guarantee. The installation instructions for professionally qualified personnel must be followed. Incorrect installation may causeharm or injuryto people,animals or belongings.The manufacturer cannot beheldresponsibleforsuch harmorinjury.

The oven can be located high in a column or under a worktop. Before fixing, you must ensure good ventilation in the oven space to allow proper circulation of the fresh air required for cooling and protecting the internal parts. Make the openings specified on last page according to the type of fitting.

1.5 Waste management and environmental protection

This appliance is labelled in accordance with European Directive 2012/19/EU regarding electric and electronic appliances (WEEE). The WEEE contain both polluting substances (thatcanhaveanegativeeffect on

the environment)and base elements (thatcan be reused). Itis important that the WEEE undergo specific treatments to correctly remove and dispose of the pollutants and recoverall the materials. Individuals can play an important role in ensuring that the WEEE do not become an environmental problem;itisessentialtofollowafew basicrules:

- the WEEE should not be treatedasdomesticwaste;

- the WEEE should be taken to dedicated collection areas managed by the towncounciloraregisteredcompany.

In many countries, domestic collections may be available for large WEEEs.

When youbuy anew appliance,the old one can be returned to the vendor who must accept it freeof charge as aone-off, as long asthe appliance isof an equivalenttypeandhasthe same functions as the purchasedappliance.

SAVINGAND RESPECTINGTHEENVIRONMENT

Where possible, avoid pre-heating the oven and always try to fill it. Open the oven door as infrequently as possible, because heat from the cavity disperses every timeit is opened.For a significantenergysaving, switch off the oven between 5 and10minutes beforethe planned endof the cooking time, and use the residual heat that the oven continues to generate. Keep the seals clean and in order, to avoid any heat dispersal outside of the cavity. If you have an electric contract with an hourly tariff, the "delayed cooking" programme makes energy saving more simple, moving the cookingprocesstostartatthe reducedtarifftime slot.

EN 04

1.6 Declaration of compliance

The parts of this appliance that may come into contact with foodstuffs complywith the provisionsofEECDirective89/109.

By placing the mark on thisproduct, weareconfirmingcomplianceto all relevant European safety, health and environmental requirements which areapplicableinlegislationforthisproduct.

2. Product Description

2.1 Overview

With this the Candy Hoover Group, declares that this appliance marked with complies with the essential requirements of the Directive 2014/53/EU.

To receive a copy of the declaration of conformity, please contact the manufacturerat:www.candy-group.com.

1. Control panel

2. Shelf positions (lateral wire grid if included)

3. Metal grill

4. Drip pan

5. Fan (behind the steel plate)

6. Oven door

2.2 Accessories (According to model)

Drip pan

Lateral wire grids

Collects the residues thatdripduringthe cookingoffoodsonthegrills.

Metal grill

Holds baking trays and plates.

Lateral wire grid if included.

2.3 First Use

PRELIMINARYCLEANING

Clean the oven before using for the first time. Wipe over external surfaces with a damp soft cloth. Wash all accessories and wipe inside the oven with a solution of hotwater andwashingup liquid. Set theemptyoventothemaximumtemperatureandleaveonforabout1hour, thiswillremoveanylingering smells of newness.

EN 05

3. Use of the Oven (According to model)

3.1 Display description

1. Thermostat selector knob

2. Thermostat signal lamp

3. End of cooking

4. Cooking time

5. Temperature or clock display

6. LCD display adjustment controls

7. Minute minder

WARNING : thefirst operation to carry outafter the oven has beeninstalled or followingthe interruption of powersupply (thisis recognizable the display pulsating and showing ) issetting thecorrect time. The bottomrightLEDflashesatthesametime( ).

This is achievedas follows.

•Set time with buttons."-" "+"

•Pushthe Menu buttonor than the clock is setted.wait5 seconds

ATTENTION: Theovenwillonlyoperatesetting theclock

8. Clock setting

9. Wifi signal lamp

10. Function selector knob

FUNCTION HOW TO DEACTIVATE WHAT IT DOES

•Child Lock function is activated by touching Set (+) for a minimum of

KEY LOCK

MINUTE MINDER

COOKING

TIME

seconds. From this moment on all other function are locked5and the display will flash STOP and presettimeintermittently.

•Push the central button 3 times

•Press the buttons "-" "+" to set the required time

•Release all the buttons

•Select the cookingfunction withthe oven function knob, thetemperature you want to cookwith the thermostat knob.

• Pushthecentral button1 times

• Press thebuttons"-" or "+"toset the lenghtofcookingrequired

• Releaseallbuttons NOTE: If the oven is switched off or the lamp is functioning, the cooking time schedulefunctionwill not work.

HOW TO USE

3 sec intervals

•Child Lock function isdeactivated by touching touchpad Set (+) again for a minimum of seconds. From this moment on all functions are selectableagain.

•When the set time has elapsed, an audible alarm is activated this alarm will stop on its own, however it can be stopped immediately by pressinganybutton.

•Push any button to stop the signal. Push the central button to return to the clock function.

full stop after

•Sounds an alarm at the end of the set time.

•During the process, the display shows the remaining time.

• It allows to preset the cooking time requiredforthe recipechosen.

• To check how long is left to run press the MENUbutton1 time.

• To alter/change the presettimepress MENU and"-" "+" buttons.

12:00

NOTE

•Allows to use the oven as alarm clock (could be activated either with operating the ovenorwith outoperatingthe oven)

•At the end of the program the program gives 3 warning signals and “End” appears on thedisplay. Set the function selector switch to "0" to returntothe clock function.

END OF

COOKING

•Select the cookingfunction withthe oven function knob, thetemperature you want to cookwith the thermostat knob.

•Pushthecentralbutton times2

•Press the buttons "-" "+" to set the time at which you wish the oven to switchoff

•Releasethebuttons NOTE: If the oven is switched off or the lamp is functioning, the cooking time schedulefunctionwill not work.

•At the time set, the ovenwillswitch off. To switch off manually, turn the ovenfunctionselectorto positionO. •To check the preset time push the

•Enables you to set the end of cookingtime

centralbutton2 times

•To modify the preset time press buttonsMENU+ "-" "+"

EN 06

•This function is typically used with “cookingtime” function. For exampleif the dishhas tobecooked for 45 minutes and needs to be ready by 12:30, simply select the required function, set the cooking time to 45 minutes and the end of cooking time to 12:30.

•At the end of the cooking set time, the oven will switch off automatically and an audible alarmwillring.

•Cooking will start automatically at 11:45 (12:30 minus 45 mins) and will continue until the pre-set end-of-cooking-time, when the oven will switch itself off automatically.

ELETTRONICA ZEROWIFI FUNCTION

For allthedetails related to thelinkbetweenapp andproduct,refer to theQuickGuide. Wi Fihas two differentpositionson thecookingselector:

•WiFion:Wi Fi is switched on only if the oven is already enrolled to your device. In this position the oven will be only controlled by remote.

•WiFireset:After leaving the selector on Wi Fi reset for 30”, Bluetooth will switch on and you will be able to enroll the oven to your device within5’.

If the enrollment is successful, the oven will be controlled by remote and the Wi Fi icon will switch on. If the enrollment is unsuccessful, Wi Fiwill switch off andthe oven will bereset.

To proceed withanew enrollment the cookingprogram selector hastobe turnedoutfromWi Firesetpositionand moved again onit.

Note: Install the App on yourdevice before startingenrolling Note: Thedevicewhere the App isinstalledmusthaveBluetoothactivated Note: ForbothWi Fipositions,thetouch buttons do notwork. Note: It is important to establish a good Wi-Fi signal strength between the home router and the appliance. When the oven is trying to

connect toroutertheiconwill blink3”on and1”off, whenit isalreadyconnectedtheicon willswitchon.

1 2

3 4

HOOVER

For detailed informationabout HOW TO CONNECT your ONE appliance andHOWTOUSEit at its best, go toFihttp://wizardservice.candy-hoover.com/

1. Program selection / 2. Program duration / 3. Cooking start setting / 4- Dedicated recipes selection / 5. Offline and vocal assistant /

6. Tips, suggestions and online user manual

3.2 Cooking Modes

Function

Dial

T °C

Suggested

180

190

Function (Depends on the oven model)

LAMP: Turns on the oven light.

DEFROST: When the dialis set to this position. The fan circulates air at room temperaturearound thefrozenfood so that itdefrosts in a

fewminuteswithouttheprotein content ofthefoodbeing changedoraltered.

FAN COOKING: We recommend youuse this method forpoultry, pastries, fish and vegetables. Heat penetrates into the food better and both thecookingand preheating times are reduced. You can cook different foods at the sametime with orwithout the samepreparation in one or morepositions.Thiscookingmethodgives evenheatdistributionand thesmellsarenotmixed.

Allow abouttenminutesextrawhen cookingfoodsat thesametime.

The function allowsyouto cook ina healthier way, by reducing the amount of fat or oilrequired. Thanks tothe useofthe grilland

""ECO

fan combined with a pulsating cycle of air, it will retain the moisturecontent of the food, grilling the surface and using a shorter cooking time, without compromisingontaste.

It is particularly suitableforcooking meat, roasted vegetables and omelettes. The cycle ofpulsed airkeepsthe humidityinside the oven and the moisturecontent ofthefood,preserving thenutritionalvaluesand ensuringarapiduniform cookingprocess.

Tryall yourrecipesandreducethe amountofdressingyou usuallyuseandexperiencethe lightnessofthisnewfunction!

FAN+LOWERELEMENT: Thebottomheatingelementis used with thefan circulatingtheair inside the oven. This method is idealfor juicy fruit flans, tarts,quichesandpâté.

210

It preventsfoodfrom dryingandencourages risingincakes, breaddough andotherbottom-cooked food. Place the shelf inthebottomposition.

CONVENTIONAL COOKING: Both top and bottom heating elements are used. Preheat the oven for about ten minutes. This method is ideal foralltraditionalroastingand baking.Forseizingredmeats,roastbeef, leg of lamb, game,bread,foilwrappedfood (papillotes),flaky

220

pastry. Placethefoodand itsdishonashelfinmidposition.

GRILL: use the grillwiththedoorclosed. The topheatingelement is usedalone and youcanadjust the temperature. Fiveminutes preheating is required to get the elementsred-

hot. Successis guaranteed for grills, kebabs and gratin dishes. White meats shouldbe putat a distance from thegrill; the cookingtime is

230

longer, butthe meat will betastier.You canputredmeatsand fish fillets ontheshelfwith the drip tray underneath.Theovenhas two grill positions: Grill: 2140 W Barbecue: 3340W

FANASSISTEDGRILL :usetheturbo-grillwiththedoorclosed. The top heating element is used with the fan circulating the air inside the oven. Preheating is necessary for red meats but not for white

meats. Ideal for cooking thick food items, whole pieces such as roast pork, poultry, etc. Place the food to be grilled directly on the shelf

200

centrally, at the middlelevel. Slide the drip tray under the shelf to collect the juices. Make sure that the food is not too close to the grill. Turnthe foodoverhalfway through cooking.

220

PIZZA:Withthisfunctionhotaircirculatedin theoventoensure perfectresult fordishes suchaspizzaorcake.

WIFI ON: Oven allows wificonnection.

WIFI RESET:Itallows wificonnectiontobe restarted.

*Tested in accordance with the CENELEC EN 60350-1 used for definition of energy class.

EN 07

4. Oven cleaning and maintenance

4.1 General notes on cleaning

The lifecycle of the appliance can be extended through regular cleaning. Wait for the oven to cool before carrying out manual cleaning operations. Never use abrasive detergents, steel wool or sharp objects for cleaning, so as to not irreparably damage the enamelled parts. Useonly water, soap or bleach-based detergents(ammonia).

GLASS PARTS

It isadvisable to cleanthe glass windowwith absorbent kitchen towel after every use of the oven. To remove more obstinate stains, you can use a detergent-soaked sponge, well wrung out, and then rinse with water.

OVENWINDOWSEAL

If dirty, thesealcanbecleanedwithaslightlydampsponge.

4.2 Hydro Easy Clean Function

The procedure uses steam tohelp removeremainingfat andfood particlesfromthe oven.HYDRO EASYCLEAN

1. Pour300mlof waterintothe containeratthebottomoftheoven.HYDRO EASYCLEAN

2. Set the oven function to Static( )or Bottom( )heater

3. Set the temperaturetothe iconHYDRO EASYCLEAN

4. Allow the programtooperate for30 minutes.

5. After 30 minutesswitchofftheprogramand allowtheoventocooldown.

6. When the appliance is cool, clean the inner surfaces of the oven with a cloth. Warning: Makesurethattheapplianceiscoolbefore youtouch it. Caremustbetakenwith allhotsurfacesasthereisariskofburns.

Use distilledor drinkablewater.

ACCESSORIES

Clean accessories with awet, soapyspongebeforerinsing anddrying them: avoidusingabrasivedetergents.

DRIP PAN

After using the grill, remove the pan from the oven. Pour the hot fat into a container and wash the pan in hot water, using a sponge and washing-up liquid. If greasy residues remain, immerse the pan in water and detergent. Alternatively, you can wash the pan inthe dishwasheror use a commercial ovendetergent.Neverput adirtypanback intotheoven.

300 ml

4.3 Maintenance

REMOVINGANDCLEANINGWIRERACKS

1- Removethewireracksbypullingtheminthedirectionofthearrows(seebelow) 2- To cleanthewireracks eitherputtheminthedishwasheroruseawetsponge,ensuringthattheyaredried afterwards. 3- After the cleaning processinstallthewireracksin reverseorder.

REMOVALOF THEOVENWINDOW

1. Open the frontwindow.

2. Open the clamps of the hinge housing on the right andleftsideofthefrontwindow bypushingthemdownwards.

3. Replacethewindowbycarryingouttheprocedureinreverse.

EN 08

LOW-E

REMOVALAND CLEANINGOFTHEGLASSDOOR

1. Open the oven door.

2.3.4. Lock the hinges, removethescrewsandremovetheuppermetalcover bypullingitupwards.

5.6. Remove the glass, carefully extracting itfrom theovendoor(NB:inpyrolyticovens, alsoremovethe secondandthirdglass(ifpresent)).

7. Attheendof cleaning or substitution,reassemblethepartsinreverseorder. On all glass, the indication "Low-E" must belegible andpositioned on the leftside of the door, close to the left-handlateralhinge. Inthis way, the printed label of the firstglasswillbeinsidethe door.

EN 09

CHANGING THE BULB

1. Disconnect the ovenfromthemainssupply.

2. Undo the glass cover, unscrew thebulbandreplaceitwithanewbulbofthesametype.

3. Once the defectivebulbisreplaced,replacetheglasscover.

Troubleshooting

5.1 FAQ

PROBLEM POSSIBLE CAUSE SOLUTION

The oven does not heat up

No reaction of the touch

user interface

The clock is not set Set the clock

A cooking function and

temperature has not been set

Steam and condensation on

the user interface panel

Ensure that the necessary

settings are correct

Clean with a microfiber cloth the user

interface panel to remove the

condensation layer

EN 10

Güvenlik uyarıları

• Pişirme sırasında nem, fırın içinde veya kapı camının içinde yoğunlaşabilir. Bu normal. Bu etkiyi azaltmak için, fırını 10-15 dakika çalıştırınız sonra yiyeceklerinizi fırının içine koyunuz. Fırın pişirme sıcaklığına ulaştığında yoğunlaşma ortadankalkar.

• Sebzeleri açık bir tepsi yerine kapaklı bir kapta pişiriniz.

• Pişirme tamamlandıktan sonra, 15-20 dakikadan daha uzun bir süre fırında yiyecek bırakmaktan kaçının.

• UYARI: Cihaz ve aparatları kullanım sırasında ısınır. Isınmış parçalaradokunmaktankaçınınız.

•UYARI: Fırın kullanımdayken erişilebilir parçalar çok sıcak olabilir. Çocuklar güvenli bir mesafede tutulmalıdır.

• Bu cihaz, 8 yaş ve üzeri çocuklar ve fiziksel, duyusal veya zihinsel yetenekleri veya bilgi ve tecrübe açısından yetersiz kişiler tarafından ancak yetişkin bir bireyin denetiminde ve cihazın nasıl kullanılacağına dair verilen talimatların uygulanması durumunda ve oluşabilecek tehlikleri kavradıkları takdirde güvenle kullanılabilir.

• Çocuklar cihazlaoynamamalıdırlar.

• Cihazın temizlik ve bakımı gözetmen olmaksızın çocuklartarafından yapılmamalıdır.

• Kullanım sırasında cihaz ısınabilir. Fırının içindeki ısıtma elemanlarının dokunurken dikkatli olunmalıdır.

UYARI: Erişilebilir parçalar kullanım sırasında ısınabilir. Küçük çocuklaruzak tutulmalıdır.

• Fırın kapak camınıtemizlerken kuvvetli aşındırıcı temizleyiciler veya keskin metal kazıyıcılar kullanmayın çünkü bu camın kırılmasına veya yüzeyinçizilmesine neden olabilir.

• Koruma çıkarılmadan önce fırınkapatılmalıdır ve temizlikten sonra koruma parçası talimatlara uygunolarak yerine koyulmalıdır.

• Sadece bu fırın için önerilen sıcaklık probu kullanın.

• Fırını temizlemerken buharlı temizleyiciler kullanmayınız.

• Besleme kablosuna etikette belirtilen gerilimi, akımı ve yükü kaldırabilecek, toprak bağlantısı olan bir fiş takın. Prizin etikette belirtilen yüke uygun, toprak bağlantısı yapılmış ve çalışır durumda olması gerekir. Topraklama iletkeni sarıyeşil renklidir. Bu işlem yalnızca uygun yetkinliğe sahip personel tarafından gerçekleştirilmelidir. Prizle cihazın fişi arasında uyumsuzluk olması

durumunda, yetkin bir elektrik ustasından prizi uygun tipte bir prizle değiştirmesini isteyin. Fiş ve priz kurulumun yapıldığı ülkede geçerli olan normlara uygun olmalıdır. Güç kaynağı bağlantısı, cihazla güç kaynağı arasına maksimum bağlı yükü kaldırabilecek ve geçerli mevzuata uygun olan omnipolar bir devre kesici yerleştirilerek de yapılabilir. Sarı-yeşil topraklama kablosu devre kesici tarafından kesintiye uğratılmamalıdır. Priz veya bağlantı için kullanılan omnipolar devre kesici, cihazın kurulumu yapıldığında kolayca erişilebilir durumda olmalıdır.

•Bağlantı, fişin erişilebilirdurumda tutulması veya kablolama kurallarına uygun şekilde sabit kablo tesisatına bir anahtarın eklenmesi yoluyla kesilebilir.

•Güç kablosu hasarlıysa üreticiden temin edilen bir kablo veya özel bir demet ile ya da müşteri hizmetleri departmanıyla iletişim kurularak değiştirilmelidir.

•Güç kablosu H05V2V2-F tipi olmalıdır.

•Yukarıdaki yönergelere uyulmaması cihazın güvenliğini tehlikeye atabilir ve garantiyi geçersiz kılabilir.

•Temizlemeden önce dökülen malzemeler temizlenmelidir.

•Pirolitik temizleme işlemi sırasında yüzeyler normalden daha fazla ısınabilir; bu nedenle çocuklargüvenli bir mesafedetutulmalıdır.

•Cihaz, aşırı ısınmayı önlemek için dekoratif bir kapınınarkasına monteedilmemelidir.

•Rafı fırının içine yerleştirirken stopun yukarıya baktığından ve bölmenin arka tarafında olduğundan emin olun.

Raf, bölmeye tamamen girerekyerleştirilmelidir.

• UYARI: Fırın duvarlarını alüminyum folyoyla kaplamayın veya mağazalardan alınan tek kullanımlık koruma malzemelerini kullanmayın. Alüminyum folyo veya diğer tüm koruma malzemeleri, sıcak emayeyle doğrudan temas ettiğinde iç yüzeylerdeki emayenin erimesine ve bozulmasına neden olma riski taşımaktadır.

• UYARI: Fırın kapağı contasını kesinlikle çıkarmayın.

• Cihazı anma frekanslarından çalıştırmak için ek işlem/ayarlamagereklideğildir.

TR 11

Özet

Genel Açıklamalar

Ürün Açıklaması

Fırının Kullanımı

1.1 Güvenlik ipuçları

1.2 Elektriksel güvenlik

1.3 Tavsiyeler

1.4 Kurulum

1.5 Atık yönetimi

1.6 Uygunluk beyanı

2.1 Genel bakış

2.2 Aksesuarlar

2.3 İlk kullanım

3.1 Gösterge açıklamaları

3.2 Pişirme modları

Fırının Temizlenmesi ve Bakımı

Sorun Giderme

4.1 Temizleme hakkında genel notlar

4.2 Kolay Temizlenme Fonksiyonu

4.3 Bakım

• Yan ızgaraların çıkarılması ve temizlenmesi

• Fırın kapağının sökülmesi

• Camın sökülmesi ve temizlenmesi

• Ampulün değiştirilmesi

5.1 Sorun giderme

• Tüketici hizmetleri

• Garanti belgesi

TR 12

1. Genel Açıklamalar

Ürünlerimizden birinitercihettiğiniz için teşekkürederiz. Fırınınızdan en iyi sonuçları almakiçin bukılavuzu dikkatle okuyun ve daha sonra başvurmak için saklayın. Fırının montajından önce, herhangi bir onarım gerekmesi halinde müşteri hizmetleri personeline vermek üzere serinumarasınınot edin. Fırınıambalajındançıkardıktan sonra nakliye sırasında hasar almamış olduğunu kontrol edin. Eğer tereddüdünüz varsa fırını kullanmayın ve tavsiye almak için kalifiyebir teknisyenebaşvurun.

Tüm ambalaj malzemelerini (plastik torbalar, polistiren, vidalar) çocukların erişemeyeceği yerlerde tutun. Fırın ilk kez çalıştırıldığında güçlü bir duman kokusu oluşabilir, bunun nedeni fırın ilk kez ısındığında yalıtım panelleri üzerinde bulunan yapışkan maddenin yanmasıdır. Bu kesinlikle normal bir durumdur ve oluştuğu zaman dumanın yayılması beklendikten sonra yiyeceklerin fırının içine konulması gereklidir. Bu dokümanda verilen açıklamalarauyulmamasıhalindeortaya çıkabilecekdurumlar içinimalatçıherhangibirsorumluluk kabuletmez.

NOT: Bu kılavuzda belirtilen fırın işlevleri, özellikleri ve aksesuarları satın almış olduğunuz modele bağlı olarak farklılıkgösterecektir.

1.1 Güvenlik İpuçları

Fırın sadece kullanım amacına uygun biçimde kullanılmalıdır, kullanım amacı yiyeceklerin pişirilmesidir; başka bir amaç için, örneğin bir ısı kaynağı olarak kullanılması uygunsuz ve bu nedenle tehlikeli kullanım olarak değerlendirilir. Uygunsuz, hatalı veya makul olmayan kullanım sonucunda ortaya çıkabilecek her türlü zarardanimalatçı sorumlututulamaz.

Herhangi bir elektrikli cihazın kullanımı sırasında bazı asli kurallara uyulması gereklidir:

1.2 Elektriksel Güvenlik

ELEKTRİK BAĞLANTILARINI BİR ELEKTRİKÇİNİN YA DA KALİFİYE BİR TEKNİSYENİNYAPMASINI SAĞLAYIN

Fırının bağlanmış olduğu elektrik beslemesinin montajın yapıldığı ülkede yürürlükte bulunan yasalara uygun olması gereklidir. Bu açıklamalara uyulmaması durumunda ortaya çıkabilecek zararlar için imalatçı herhangi bir sorumluluk kabul etmemektedir. Montajın yapıldığı ülkede yürürlükte bulunan yasalarabağlıolarakfırınıntopraklı birprizyadabütünkutuplarıayıran birdevre kesici kullanılarak elektrik beslemesine bağlanması gereklidir. Elektrik beslemesinin uygun sigortalarlakorunmasıvekullanılankabloların fırının doğru bir şekilde beslenebilmesineyeterlikapasitede olmasıgereklidir.

BAĞLANTI

Fırın, faz arası veya faz nötr arası 220-240 VAC 50 Hz olan bir elektrik beslemesine bağlanması gereken bir elektrik kablosu ile sağlanmıştır. Fırın elektrik beslemesine bağlanmadan önce aşağıdakilerin kontrol edilmesi gereklidir:

1.3 Tavsiyeler

Fırını herkullandıktansonrayapılacakkısa süreli temizlik işlemi fırınınher zaman mükemmel temizlikte kalmasını sağlayacaktır.Fırının yan duvarlarını alüminyum folyo veya mağazalardan satın alınabilecek tek kullanımlık koruma malzemeleri ile kaplamayın. Sıcak emaye ile temas eden alüminyum folyo veya başka herhangi bir koruma malzemesi erime riskine sahiptir ve emaye iç yüzeylerin

- elektrik fişini prizdençıkarmakiçin aslakablodantutarak çekmeyin;

- elleriniz yadaayaklarınızıslak veyanemliiken cihazadokunmayın;

- genellikle adaptörlerin, çoklu prizlerin ve uzatma kablolarının kullanılması tavsiyeedilmez;

- arızalanması ve/veya düzgün çalışmaması durumunda cihazı kapatın ve kurcalamayın.

- etikettebelirtilen gerilimdeğeri;

- devrekesicininayarı. Fırının topraklama klemensine bağlanmış olan topraklama kablosunun elektrik

beslemesinin topraklamaklemensinebağlanmasıgereklidir.

UYARI

Fırını elektrikbeslemesinebağlamadanönce, elektrik beslemesinintopraklama klemensinin sürekliliğini kontrol etmesi için kalifiye bir elektrikçiye başvurun. Fırının topraklama klemensine bağlanmaması veya topraklama bağlantısının sürekliliğinde bir sorunolmasısonucunda ortayaçıkabilecekher türlü kaza veya zarardaimalatçı herhangibirsorumlulukkabuletmemektedir.

NOT: fırında bazı bakım işlemleri yapılması gerektiğinden, montajın yapılmış olduğu alandan çıkarılması halinde fırının bağlanabileceği başka bir prizin yakınlarda bulunması tavsiye edilir. Elektrik kablosunun sadece teknik servis personeli ya da eşdeğer niteliklere sahip teknisyenler tarafından değiştirilmesi gereklidir.

bozulmasına neden olabilir. Fırınınızın aşırı kirlenmesini ve bunun sonucunda duman kokusu oluşmaması için fırını çok yüksek sıcaklıklarda kullanmamanızı tavsiye ederiz. Pişirme süresini uzun tutmak ve sıcaklığı biraz düşürmek daha iyidir. Fırın ile birlikte verilen aksesuarlara ek olarak, sadece çok yüksek sıcaklıklaradayanıklıtabaklarve pişirmekaplarıkullanmanızıtavsiye ederiz.

1.4 Kurulum

Ürünün kurulumufirmanın yetkilendirilmiş servis/yetkilendirilmiş kişitarafından yapılmalıdır. Yetkisiz kişi ve kuruluşlar tarafından yapılan kurulumlardan doğan tüm ürün, kişi, mahal hasarları firmanın sorumluluğunda değildir. Kurulum yapılacak mahalin ürünün çalışma ve teknik koşullara kullanma kılavuzunda belirlenen kurallara uygun şekilde olması/sağlanması tüketicinin sorumluluğundadır. Eğer tüketici tarafından yapılan kurulum nedeniyle ortaya çıkan hataların düzeltilmesi için imalatçının desteği gerekirse, bu destek garanti kapsamında sağlanmaz. Kurulum açıklamaları profesyonel kalifiye personel içindir vekurulumsırasındauyulmasıgereklidir. Hatalıkurulum insanların ve evcil hayvanların yaralanmasına ve eşyaların zarar görmesine neden olabilir. Böylesi bir yaralanma veya zarariçin imalatçısorumlu tutulamaz.

Fırın yüksekbir mutfak dolabınayadatezgah altınayerleştirilebilir. Sabitlemeden önce, iç parçaların soğutulması ve korunması için gerekli temiz havanın uygun biçimde dolaşımının sağlanması amacıyla fırının etrafında iyi bir havalandırma

Bu cihaz ev standartlarında kullanılmak üzere üretilmiştir. Profesyonel kullanım veya ticare kullanım için kurulmuş olması

durumunda, ilgili ticari hususta uygulanan standartlar dikkate alınmalıdır.

sağlandığından emin olun. Sabitleme şekline göre son sayfada belirtilen hava alma açıklıklarını açın. Bu cihaz ev standartlarında kullanımına uygun olarak tasarlanmış ve üretilmiş olup ticari ve profesyonel amaçla kullanımlara uygun değildir. Ticari kullanımlarda (ev harici) ürün teslim tarihinden itibaren 1 (bir) ay sure ile üretim hatalarına karşı garanti kapsamındadır. Ticari kullanımlarda cihazın ömrü kısalabilir ve kullanım beklentilerini karşılamayabilir. Ev ve benzeri kullanım amacıyla örtüşmeyen (ev veya ev tipi bir mekanda bile olsa) kullanım dolayısıyla cihazdameydanagelebilecekherhangi bir arıza ve/veyahasarüretici/ satıcı tarafından kabul edilmeyecektir. Ticari amaç ilekullanılan ürünlerde, Malın ayıplı olduğu teslim sırasındaaçıkçabelliisealıcı2 (iki) güniçinde durumu satıcıya ihbar etmelidir. Açıkça belli değilse alıcı malı teslim aldıktan sonra 8 (sekiz) gün içinde incelemek veya incelettirmekle ve bu inceleme sonucunda malın ayıplı olduğu ortaya çıkarsa, haklarını korumak için durumu bu süre içinde satıcıya ihbarla yükümlüdür.

1.5 Atık yönetimi ve çevrenin korunması

Bu cihaz, 2012/19/EU Atık Elektrikli ve Elektronik Cihazlar (WEEE) hakkında Avrupa Yönergesine göre etiketlenmiştir. WEEE hem kirletici maddeleri (çevreye olumsuz bir etkisi olabilecek), hem de baz elemanları (yeniden kullanılabilir olan) içermektedir. Kirletici maddelerin bertaraf edilmesi ve tüm malzemelerin geri dönüştürülebilmesi için WEEE'lerin doğru bir şekilde tasnif

edilmesi önemlidir. WEEE'lerin çevre açısından bir sorun oluşturmaması için bireyler önemli bir rol oynayabilir; birkaç temel kurala uyulması son dereceönemlidir:

- WEEE evsel atıkolarakişlemgörmemelidir;

- WEEE belediyeler veya tescilli bir firma tarafından yönetilen belirlenmiş toplama alanlarına götürülmelidir.

Birçok ülkede, büyük WEEE'ler için şehir içinde toplama noktaları

bulunmaktadır. Yeni bir cihaz satın aldığınızda, eski cihazın satın alınan cihazla aynı tipte olması ve aynı işlevlere sahip olması durumunda eski cihazı ücretsiz olarakbirebirkabuletmesi gereken satıcıyaiade edebilirsiniz.

ENERJİ TASARRUFU VEÇEVREYESAYGI

Mümkün olduğunda, fırını önceden ısıtmaktan kaçının ve her zaman doldurmaya çalışın. Fırın kapağını olabildiğince az açın çünkü her açılışında ısı kaybı oluşur. Önemli oranda enerji tasarrufu için, fırını planlanan pişirme süresinden 5 ile 10dakika daha önce kapatınvefırının üretmeyedevamedeceği artakalan ısıyı kullanın. Isının hazne dışına kaçmaması için contaları temiz ve düzgün tutun. Eğer saatlik bir tarife ile ücretlendirilen bir elektrik sözleşmeniz varsa, pişirmeye başlama saatini indirimli fiyat tarifesinin saatine taşıyan "gecikmeli pişirme" programı ile daha basit bir şekilde enerji tasarrufu yapılabilir.

TR 13

1.6 Uygunluk beyanı

Bu cihazın gıdalarla temas edebilecek parçaları 89/109 EEC Yönetmeliği hükümlerine uygundur.

Bu ürüne işaretinin yerleştirilmesi ile cihazın bu ürün için yürürlükte olan tüm ilgili Avrupa güvenlik, sağlık ve çevre standartlarına uygun olduğunu doğruluyoruz.

2. Ürün Açıklaması

2.1 Genel bakış (Modele göre değişmektedir.)

• Bununla Candy Hoover Grubu, ile işaretli bu cihazın 2014/53 / AB sayılıDirektifinesasşartlarınauygunolduğunubeyaneder.

Uygunluk beyannamesinin bir kopyasını almak için lütfen www.candygroup.comadresindenüreticiyebaşvurun.

1. Kontrol paneli

2. Raf konumları (eğer varsa yan tel raflar)

3. Metal ızgara

4. Tepsi

5. Fan (çelik plakanın arkasında)

6. Fırın kapağı

2.2 Aksesuarlar

Tepsi

Yiyeceklerinızgara üzerindepişirilmesi sırasındadamlayan sularınıtoplar.

Yan tel ızgaralar

Eğer dahil yan tel ızgaralar.

Metal ızgara

Pişirme tepsilerini ve tabaklarını tutar.

2.3 İlk Kullanım

İLK TEMİZLEME

İlk kez kullanmadan önce fırını temizleyin. Dış yüzeyleri yumuşak bir ıslak bezle silin. Tüm aksesuarları yıkayın ve fırının içini sabunlu su ve sıvı bulaşık deterjanı karışımına batırılmış bir bezle silin. Boşfırını maksimumsıcaklık değerine ayarlayın ve yaklaşık 1saat çalıştırın, buşekilde fırının yeniolmasından kaynaklıtümkokular giderilecektir.

TR 14

3. Fırının Kullanımı (Modele göre değişmektedir.)

3.1 Gösterge açıklamaları

1- Sıcaklık seçici düğme 2- Termostat sinyal lambası 3- Saat ayarı 4- Dakika hatırlatıcı 5- Saat ekranı 6- LCD ekran ayar kontrolleri 7- Pişirme sonu

UYARI: Fırın yerine monte edilip elektrik bağlantısı yapıldığındaveyaelektrik beslemesi kesiliptekrargeri geldiğinde, gösterge yanıp sönmeye başlar. Bu aşamada saatin ( ) ayarlanması gerekir. Sağ alt LED aynıandayanıpsönüyor ( ) Saat aşağıdakigibiayarlanır:

• "-" "+" Butonlarıylazamanıayarlayınız.

• Menü düğmesine basın veya5 dk. bekleyin, ardındansaatayarlanır.

UYARI: Fırınancaksaatayarlandıysa çalışmaya başlar.

8- Pişirme süresi 9- Wifi sinyal lambası 10- Fonksiyon seçici düğme

PROGRAM DEVREDEN ÇIKARILMASI İŞLEVİ

ÇOCUK

KİLİDİ

ZAMAN

SAYACI

PİŞİRME

SÜRESİ

PROGRAMI

DEVREYE SOKULMASI

• Çocuk Kilidi işlevini en az 5 saniye boyunca Set (Ayar) (+) düğmesine dokunarak etkinleştirebilirsiniz. Bu andan itibaren diğer tüm işlevler kilitlenir ve ekran 3 saniye aralıklarla yanıp sönerek STOP (DURDUR) metnini ve kesintisiz olarak önceden ayarlanansaatigösterir.

•Orta düğmeye kez basınız

•Arzu ettiğiniz süreyiayarlamak için "-" "+" düğmelerinebasın.

•Bütün düğmelerebasmaya son verin.

• Fırın işlev düğmesiyle pişirme işlevini, termostat düğmesiyle pişirmek istediğinizsıcaklığı seçin.

•Ortadüğmeye kez basınız1

•Arzu ettiğiniz pişirme süresini ayarlamak için "-" "+" düğmelerine basın.

•Bütün düğmelere basmaya son verin. NOT: Fırın kapanırsa veya lamba çalışırsa, pişirme süresi zamanlama işlevi çalışmaz.

• Çocuk kilidi fonksiyonu tekrar dokunmatik ekrandaki(+) sembolüne en az saniye dokunarak iptal edilir.

5 Bu andan itibaren tüm fonksiyonlar tekrarseçilebilirhale gelir.

•Ayarlanan saat geçtiğinde, bir sesli alarm devreye girer. Bu alarm kendiliğinden durur, bununla birlikte herhangi bir düğmeye basarak derhal durdurulabilir.

•Ayarlanmış olan süre sona erdiğinde, fırın otomatik olarak kapanır. Pişirme işlemini daha önce durdurmak istemeniz durumunda, işlev seçicisini 0 konumuna getirin veya süreyi 0:00 olarak ayarlayın MENU ve"-" "+" düğmeleri.

•Ayarlanmış olan sürenin sonunda alarmı çaldırır.

•İşlem sırasındakalansüreyi gösterir.

•Seçilmiş olan tarif için gerekli olan pişirme süresini ayarlayabilmenize olanak sağlar.

•Ne kadar çalışma süresi kaldığını görmek içinMENUdüğmesine basın.

•Programlanmış olan süreyi değiştirmek için MENU ve "-" "+" düğmelerine basın.

12:00

NOT

•Fırını bir alarmlı saat olarak kullanabilmenize olanak sağlar (fırın çalışırken de çalışmıyorkende kullanılabilir)

•Program sonunda, program 3 uyarısinyali verirveekrandaEnd (son)yazısıgörünür. Saat işlevine geri dönmek için işlev seçici düğmeyi "0"olarakayarlayın.

PİŞİRME

SONU

PROGRAMI

• Fırın işlev düğmesiyle pişirme işlevini, termostat düğmesiyle pişirmek istediğinizsıcaklığı seçin.

• ğ basınız.2Ortadü meye kez

•Arzu ettiğiniz pişirmenin sona erme saatiniayarlamakiçin basın."+"

•Bütün düğmelere basmaya son verin.

NOT: Fırın kapanırsa veya lamba çalışırsa, pişirme süresi zamanlama işlevi çalışmaz.

•Ayarlanmış olan süre sona erdiğinde, fırın otomatik olarak kapanır. Pişirme işlemini kendiniz müdahale ederek durdurmak için fırın fonksiyon düğmesini O konumunagetirin.

TR 15

•Pişirme sonu saatini ayarlaya bilmenizeolanaksağlar.

•Ayarlanmış olan saatikontrol etmek için o ğ 2 basınız

rta dü meye kez

•Programlanmış olan saati değiştirmek için MENU ve "-" "+" düğmelerine basın.

•Bu işlev genellikle “pişirme süresi” işlevi ile birlikte kullanılır. Örneğin yiyeceğin pişme süresi45 dakikaysa ve saat12:30'da hazır olması gerekiyorsa, sadece pişirme süresini 45 dakikaya ve pişirme sonu saatinide12:30'aayarlamanız yeterlidir.

•Programlanmış olan pişirme süresinin sonunda fırın otomatik olarak kapanır ve bir seslialarmverilir.

•Pişirme saat 11:45'de (12:30 eksi 45 dakika) otomatik olarak başlar ve programlanmış olan pişirme süresi (45 dakika) kadar sürdükten sonra fırın otomatik olarakkapanır.

ELETTRONICA SIFIRWIFI İŞLEVİ

Uygulama ile ürün arasındaki bağlantıylailgilitümayrıntılariçin,HızlıKılavuza bakın. WiFi, pişirmeseçici de ikifarklı pozisyonasahiptir:

•WiFiaçık:Wifiyalnızca fırıncihazınızazaten kayıtlıysa açılır. Bupozisyonda, fırınyalnızca uzaktankumandaedilir.

• WiFi sıfırlama: WiFi sıfırlamadaki seçiciyi 30 dk. bıraktıktan sonra, Bluetooth açılacak ve 5 dk. içerisinde fırını cihazınıza

kaydedebileceksiniz. Kayıt başarılıysa, fırın uzaktan kumandayla kontrol edilir ve WiFi simgesi açılır. Kayıt başarılı değilse, WiFi kapanacak ve fırın sıfırlanacaktır. Yenikayıtla devametmekiçinpişirmeprogramıseçici WiFi sıfırlamapozisyonundan döndürülmelivetekraro pozisyonageçirilmelidir.

Not: Kayda başlamadanönceUygulamayı cihazınızayükleyin Not: Uygulamanın yüklendiğicihazdaBluetoothetkinolmalıdır Not: Heriki WiFi pozisyonu için,dokunmatikdüğmeler çalışmaz. Not: Ev yönlendiricisi ilecihazarasındaiyibir WiFi sinyal gücü kurmak önemlidir. Fırın, yönlendiriciye bağlanmayaçalıştığında,simge3

dk. yanıp sönecekve1dk. sönecek; bağlanmışsa simge yanacaktır.

1 2

3 4

HOOVER :

ONE cihazınızı ve en iyişekilde ilgili ayrıntılı bilgi

Fi NASIL BAĞLAYACAĞINIZ NASIL KULLANACAĞINIZLA

için adresinegidin.

http://wizardservice.candy-hoover.com/

1. Program seçimi / 2. Program süresi / 3. Pişirme başlangıç ayarı / 4- Özel tarif seçimi / 5. Çevrimdışı ve sesli asistan / 6. İpuçları, öneriler ve çevrimiçi kullanım kılavuzu

3.2 Pişirme Modları

Fonksiyon

ikonu

Varsayılan

sıcaklık °C

180

190

Fonksiyon (Fırın modeline bağlıdır)

LAMBA: Fırın lambasını yakar.

BUZ ÇÖZME: Düğme bu konuma alındığı zaman fan oda sıcaklığında havayı donmuş gıdanın etrafında dolaştırır, böylece gıdanın protein

içeriği değişmeden birkaçdakikaiçindebuzu çözülür.

FANLIPİŞİRME: Buyöntemikümes hayvanları, çörekler, balık ve sebzeler için kullanmanızı tavsiye ederiz. Isıgıdanın içinedaha iyi işler ve hem pişirme, hem deısıtma süreleri azalır. Değişik gıdaları aynıveyafarklı soslarla birveya daha fazla konumda pişirebilirsiniz. Bu pişirme yöntemi ısı yayılımının eşit olmasını sağlar ve kokular birbirine karışmaz. Aynı anda farklı gıdalar pişirdiğiniz zaman fazladan yaklaşık on dakikadahabekleyin.

“ECO" fonksiyonu kullandığınız yağ miktarını azaltarak, daha sağlıklı bir şekilde pişirmenizi sağlar. Pişirme fonksiyonlarının ve kombinasyonun özel bir bileşimi sayesinde, yiyeceklerin nemini kaybetmesini önleyerek, yüzeyini kızartarak ve en kısa pişirme zamanını kullanarakyiyecekleritadındanödün vermedenpişirir.

Et, kavrulmuş sebze ve omletler için özellikle uygundur. Fan sayesinde darbeli hava döngüsü, fırındaki yiyeceklerin nemini ve besin değerlerini korurvebu sayedehızlıvehomojen birpişirmegerçekleşir.

Bu yenifonksiyonile tümtariflerideneyinveyiyeceklerde kullandığınızsos miktarınıazaltarak hafifpişirilmiş yiyeceklerinzevkinevarın!

FAN+ALT ISITICI:Alt ısıtıcı elemankullanılır, fan fırının içindeki havanın sirkülasyonunusağlar. Bu yöntem sulu meyveler, meyvelipastalar, turtalar, kişlerve etlibörekleriçinidealdir.

210

Gıdaların kurumasınıönlervekeklerin,ekmeklerin vealttanpişirilen diğergıdalarınkabarmasınıfazlalaştırır. Rafı alt konumayerleştirin.

STATİK/GELENEKSELPİŞİRME: Hem üst, hem de altısıtıcıelemanlarkullanılır. Fırını yaklaşıkondakikaöncedenısıtın. Bu yöntem her türlü geleneksel kızartma ve fırında pişirme için idealdir. Kırmızı etler, rosto, kuzu butu, ekmek, folyoya sarılmış yiyecekler (papillote), katmer

220

içindir. Gıdayı birtabağıniçinde ortarafınüzerine yerleştirin.

IZGARA:fırınkapağıkapalıiken bufonksiyonu kullanın. Üst ısıtıcı eleman tek başına kullanılır ve sıcaklık ayarı yapılabilir. Elemanların ısınması için beş dakikalık ön ısıtma gereklidir. Izgaralar,

kebaplar ve üstü örtülen yemeklerin pişirilmesinde başarı garanti edilir. Beyaz etlerinızgaradanbiraz açıkta tutulması gereklidir; pişirme

230

süresi dahauzundur, ancak et daha lezzetli olacaktır. Kırmızıetleri ve balık filetolarınıaltında damlamatepsisi ile rafınüzerine yerleştirin. Fırın iki ızgarakonumuna sahiptir:Izgara: 2140W Barbekü:3340W

FAN DESTEKLİ IZGARA: fırın kapağı kapalı iken bu fonksiyonu kullanın. Üst ısıtıcı eleman kullanılır, fan fırının içindeki havanın sirkülasyonunu sağlar. Kırmızı etler için ön ısıtma gereklidir, ancak beyaz etler için gerekmez. Kızarmış domuz, kümes hayvanları, vb gibi

200

kalın parçalar ile bütün parçaların pişirilmesi için idealdir. Pişirilecek gıdayı doğrudan orta konumda bulunan rafın ortasına yerleştirin. Suları toplamakiçinrafın altına damlamatepsisinikoyun.Gıdanınızgaraya çokyakın olmadığından eminolun. Pişirme süresinin yarısında gıdayıçevirin.

220

PİZZA:Buseçenektesıcakhavasirkülasyonuyla pizza vekek gibiyiyeceklermükemmel birşekildepişirilir.

WIFI AÇIK:Fırın,wifibağlantısınaizinveriyor.

WIFI SIFIRLAMA: WiFi bağlantısınınyenidenbaşlatılmasınaizinveriyor.

*CENELEC EN 60350-1 uyumlu olarak test edilmiştir enerji sınıfının tanımlanması için kullanılmıştır.

TR 16

4. Fırının Temizlenmesi ve Bakımı

4.1 Temizleme hakkında genel notlar

Düzenli temizlik ile cihazın kullanım ömrü uzatılabilir. Elle temizlik işlemlerini yapmadan önce fırının soğumasını bekleyin. Temizlik için asla aşındırıcı deterjanlar, çelik tel veya keskin nesneler kullanmayın, aksi takdirdeemayeparçalardaonarılamazhasarlar oluşabilir. Sadecesu, sabun veyaağartıcıbazlıdeterjanlar(amonyak) kullanın.

CAM PARÇALAR

Fırın her kullanıldıktan sonda pencerenin camının emici bir mutfak bezi ile temizlenmesi tavsiye edilir. İnatçı lekeleri temizlemek için deterjana batırılmışveiyicesıkılmış bir sünger kullanınvesonrasuiledurulayın.

FIRIN KAPAKCONTASI

Kirlendiği zamanhafifçeıslatılmışbirsüngerletemizlenebilir.

4.2 K T F Hydro Easy Clean Functionolay emizlenme onksiyonu ( )

HYDRO EASYCLEANbuharyardımıilefırınınızdakiyağ veyemekartıklarınıtemizler. 1 HYDRO EASYCLEAN. Fırınınızın – KolayTemizlenme bölümüne 300 ml su ilave edin. 2()(). Fırınınızı sabit yadataban sıcaklığına ayarlayın. 3 HYDROEASYCLEAN ( ). Isı göstergesini – KolayTemizlenme fonksiyonuna getirin.

4. Programı30dakikaçalıştırın.

5. Cihaz soğuduğunda fırınınızın iç kısmını temiz birbezletemizleyin.

Uyarı:

C önce Sihazınızadokunmadan soğuk olduğundan emin olun. ıcak yüzeylerinyanıkriskitaşıdığınıunutmayın. İçme suyu kullanın.

AKSESUARLAR

Aksesuarları sabunlu su ile ıslatılmış bir süngerle temizleyin, ardından durulayınvekurutun:aşındırıcıdeterjanlarkullanmaktan kaçının.

DAMLAMATEPSİSİ

Izgarayıkullandıktansonratepsiyifırından çıkarın. Sıcak yağı bir kaba dökün ve bir süngervesıvıbulaşık deterjanıkullanaraktepsiyisıcaksu ileyıkayın.

Eğer yap artıkları kalırsa, tepsiyi deterjanlı suya batırın. Alternatif olarak, tepsiyi bulaşık makinesinde yıkayabilir veya piyasada bulunan fırın deterjanlarınıkullanabilirsiniz.Kirlitepsiyiaslafırınagerikoymayın.

300 ml

4.3 Bakım

YAN IZGARALARINÇIKARILMASI VETEMİZLENMESİ

1- Tel rafı, ok yonunde cekerek, tutucu yuvalarından ve fırın duvarından ayrılmasını sağlayın. 2- Tel rafları bulaşıkdeterjanı,ılıksuveyumuşakbirbezyadasungerkullanarak temizleyipkuru birbezlekurulayın. 3- Temizlik işlemiardından,tel raflarıyerinetakın.

FIRIN KAPAĞININ SÖKÜLMESİ

1. Kapağıaçın.

2. Aşağı doğru iterekfırın kapağınınsağvesoltarafındabulunanmenteşeyuvalarının kıskaçlarınıaçın.

3. Bu işlemin tersiniuygulayarak kapağıyerine takın.

TR 17

LOW-E

CAMIN SÖKÜLMESİVETEMİZLENMESİ

1. Fırının kapağınıaçın.

2.3.4. Menteşelerikilitleyin,vidalarıçıkarınveyukarıdoğruçekerek üstmetal kapağıçıkarın.

5.6. Camı dikkatlibirşekildefırınkapağındançekerek çıkarın(Not:pirolitikfırınlarda ikinciveüçüncücamı(eğervarsa) daçıkarın).

7. Temizleme veye değişimişlemininsonundaparçalarısökmeişlemininters sıralamasıile toplayın. Tümcamlarınüzerinde" " kelimesinin okunabilmesi ve kapağın sol tarafında bulunması gereklidir,soldaki yataymenteşeyikapatın.Bu şekilde birinci camın baskılı yüzeyikapağıniçindekalacaktır.

Low-E

TR 18

AMPULÜNDEĞİŞTİRİLMESİ

1. Fırını elektrik beslemesinden ayırın.

2. Cam kapağısökün, ampulü sökün ve aynıtürdeyenibirampuliledeğiştirin.

3. Arızalıampuldeğiştirildiktensonracamkapağı yerinetakın.

5. Sorun Giderme

5.1 Sorun giderme

SORUN OLASI NEDENİ ÇÖZÜMÜ

Fırın ısınmıyor

Dokunmatik kullanıcı paneli

tepki vermiyor

Saat ayarlanmamış Saati ayarlayın

Bir pişirme işlevi ya da sıcaklık

ayarlanmamış

Kullanıcı panelinde buhar

veya yoğuşma var

Gerekli ayarların doğru

olduğunu kontrol edin

Yoğuşma tabakasını temizlemek için

kullanıcı panelini mikrofiber bir

bezle silin

TR 19

TÜKETİCİ HİZMETLERİ

Yetkili servislerimizden hizmet talebiniz olduğunda veya ürünlerimizle ilgili genel öneri ve talepleriniz için aşağıdaki numaradan ulaşabilirsiniz.

TÜKETİCİ HATTI: 444 03 98

Sabit telefonlardan veyacep telefonlarından alankodu çevirmeden arayınız. Ürününüzü kullanmadan önce montaj ve kullanma kılavuzunu mutlaka okuyunuz. Ürünün montaj ve kullanım kılavuzunda yer alan hususlara aykırı kullanılması, kullanım hataları ve cihazın standart kullanım şartları / amaçları haricinde kullanılması halindeürün garanti kapsamıdışında kalacaktır. Ürünün standart ve sorunsuz çalışma koşullarının sağlanması için gerekli / zorunlu olan montaj ve kullanım kılavuzunda belirtilen teknik özelliklerinin (su basıncı, voltaj değeri, gaz besleme basıncı, sigorta değeri, topraklama, yakıt cinsi, yakıt kalitesi vb.) uygun olmaması, sabit olmaması ve/veya değişken olması halinde, cihazda meydana gelebilecek arızalar ve sorunlargaranti kapsamı dışındakalacaktır. Candy Hoover Euroasia tarafından sağlanan garanti şartlarıaşağıdaki koşullarda geçersizolacaktır.

• Ürüne, yetkili servis dışındaki kişiler tarafından müdahale edilmesi, elektrik-su kesintisi ve üründen kaynaklanmayan kaçaklar garanti kapsamıdışındadır.

• Kullanım hatalarından dolayı oluşan arıza ve hasarlar, elektrik-gaz -su tesisatı ve / veya tesisat ekipmanları nedeniyle meydana gelebilecek arızalargaranti kapsamı dışındadır.

•Ürünün, müşteriye ulaştırılması sonrası yapılan taşıma işlemine bağlı arıza ve hasarlar, tüketici tarafından yapılan yanlış depolama veortam koşulları nedeniylecihazda meydana gelenhasarlar ve arızalargaranti kapsamı dışındadır.

• Hatalı elektrik tesisatı, ürünün üzerinde belirtilen voltajdan farklı voltajda kullanılması veya şebeke voltajındaki dalgalanmalar sonucu oluşan arıza ve hasarlar, doğal afetler, üründen kaynaklanmayan harici/fiziki dış etkenler, mevsimsel hava şartları ve çevresel etkenler (deprem, yangın, sel, su basması, şiddetli rüzgar, yıldırım düşmesi, kireç, nem, rutubet, toz, nakliye, taşıma, ürünün dona maruz kalması, susuz çalışma vb.) nedeniyle oluşan arızalar garanti kapması dışında kalacaktır.

• Kullanım kılavuzunda belirtilen hususlara aykırı kullanılmasından kaynaklanan arızalar vehasarlar. Yukarıda belirtilen arızaların giderilmesiücret karşılığı yapılır. Ürünün kullanım ömrü 10 (on) yıldır. Bu ürünün tanımlandığı şekilde çalışabilmesi için gerekli yedek parçaları bulundurma süresidir. Üretim yeri Türkiye'dir.

İTHALATCI FİRMA:

CANDY HOOVER EUROASIA EV GEREÇLERİ SAN. VE TİC. A.Ş. İçerenköy Mh. Hal Yolu Cd. Çayır Yolu Sk. No: 11 Sayar İş Merkezi Kat: 7 34752 Ataşehir / İSTANBUL/ TÜRKİYE Tel: 0216 466 42 42 • Fax: 0216 466 15 45 www.hoover.com.tr • servis@hoover.com.tr

ÜRETİCİ FİRMA:

CANDY HOOVER GROUP Via Privata E. Fumagalli 20861 Brugherio (MB) - ITALY Tel: 039.2086.1 • Fax: 039.2086.403 www.candy-group.com

TR 20

GARANTİ BELGESİ

ANKASTRE FIRIN

Ankastre fırın kullanma kılavuzunda gösterildiği şekilde kullanılması ve yetkili kıldığımız servis elemanları dışındaki şahıslar tarafından bakımı, onarımı veya başka bir nedenle müdahale edilmemiş olması şartıyla bütün parçaları dahil olmak üzere tamamı malzeme, işçilik ve üretim hatalarına karşı ürünün teslim tarihinden itibaren 3 ( ÜÇ ) YIL

SÜRE İLE CANDY HOOVER EUROASIA A.Ş. TARAFINDAN GARANTİ EDİLMİŞTİR.

Malın bütün parçaları dahil olmak üzere tamamı garanti kapsamındadır. Malın ayıplı olduğunun anlaşılması durumunda tüketici, 6502 sayılı Tüketicinin Korunması Hakkında Kanunun 11 inci maddesinde yer alan; a) Satılanı geri vermeye hazır olduğunu bildirerek sözleşmeden dönme, b) Satılanı alıkoyup ayıp oranında satış bedelinde indirim isteme, c) Aşırı bir masraf gerektirmediği takdirde, bütün masrafları satıcıya ait olmak üzere satılanın ücretsiz onarılmasını istem, ç) İmkan varsa, satılanın ayıpsız bir misli ile değiştirilmesini isteme, seçimlik haklarından birini kullanabilir. Tüketicinin, Kanunun 11. maddesinde yer alan seçimlik haklarından ücretsiz onarım hakkını seçmesi durumunda satıcı; işçilik masrafı, değiştirilen parça bedeli ya da başka herhangi bir ad altında hiçbir ücret talep etmeksizin malın onarımını yapmak veya yaptırmakla yükümlüdür. Tüketici ücretsiz onarım hakkını üretici veya ithalatçıya karşı da kullanılabilir. Satıcı, üretici ve ithalatçı tüketicinin bu hakkını kullanmasından müteselsilen sorumludur. Tüketicinin, ücretsiz onarım hakkını kullanması halinde malın;

• Garanti süresi içinde tekrar arızalanması,

• Tamiri için gereken azami sürenin aşılması,

• Tamirinin mümkün olmadığının, yetkili servis istasyonu, satıcı, üretici veya ithalatçı tarafından bir raporla belirlenmesi durumlarında; tüketici malın bedel iadesini alıp, ayıp oranında beden indirimini veya imkan varsa malın ayıpsız misli ile değiştirilmesini satıcıdan talep edebilir. Satıcı, tüketicinin talebini reddetmez. Bu talebin yerine getirilmemesi durumunda satıcı, üretici ve ithalatçı müteselsilen sorumludur.

Garanti uygulaması sırasında değiştirilen malın garanti süresi, satın alınan malın kalan garanti süresi ile sınırlıdır.

Malın tamir süresi 20 iş gününü geçemez. Bu süre, garanti süresi içerisinde mala ilişkin arızanın yetkili servis istasyonuna veya satıcıya bildirimi tarihinde, garanti süresi dışında ise malın yetkili servis istasyonuna teslim tarihinden itibaren başlar. Malın arızasının 10 iş günü içerisinde giderilememesi halinde, üretici veya ithalatçı; malın tüketicinin kullanımına tahsis etmek zorundadır. Malın garanti süresi içerisinde arızalanması durumunda, tamirde geçen süre garanti süresine eklenir. Malın kullanma kılavuzunda yer alan hususlara aykırı kullanılmasından kaynaklanın arızalar garanti kapsamı dışındadır. Tüketici, garantiden doğan haklarının kullanılması ile ilgili olarak çıkabilecek uyuşmazlıklarda yerleşim yerinin bulunduğu veya tüketici işleminin yapıldığı yerdeki Tüketici Hakem Heyetine veya Tüketici Mahkemesine başvurabilir.

Garanti belgesinin tekemmül ettirilerek tüketiciye verilmesi ve bu yükümlülüğün yerine getirildiğinin ispatı satıcıya aittir. Satılan mala ilişkin olarak düzenlenen faturalar garanti belgesi yerine geçmez.

Satıcı tarafından bu Garanti Belgesinin verilmemesi durumunda, tüketici Gümrük ve Ticaret Bakanlığı Tüketicinin Korunması ve Piyasa Gözetimi Genel Müdürlüğüne başvurabilir.

CANDY-HOOVER-EUROASIA EV GEREÇLERİ SAN. VE TİC. A.Ş.

Genel Müdür:

Model:..............................

Bandrol ve Seri No:...........

Teslim Tarihi Yeri: ..............

Bu bölümü, ürünü aldığınız Yetkili Satıcı imzalayacak ve kaşeleyecektir. Bu garanti belgesi ile kesilen fatura garanti süresi boyunca garanti belgesi ile muhafaza edilmesi önerilir.

Fatura Tarihi No: .................

Satıcı Firma Ünvanı: ............

TR 21

Adres:

Tel - Fax: Satıcı Firma (Kaşe ve İmza):

Conseils De Securite

• Pendant la cuisson de l’humidité peut se créer dans la cavité ou sur la surface de la porte. Le cas décrit est normal. Si on veut reduire cet effet, il faut laisser réchauffer le four 10-15 minutes avant d’introduire les aliments. L’humidité va disparaître grâce à la juste température de cuisson

• Nous vous conseillons de faire la cuisson des légumes dans un récipient avec couvercle pas sur un plateau

• Une fois que la cuisson est terminée, nous vous conseillons de ne pas laisser les aliments à l’intérior de lacavité pour plusde 15/20 minutes

• AVERTISSEMENT: L'appareil et les parties accessibles deviennent chauds pendant l'utilisation. Des précautions doivent être prises pour éviter de toucher les éléments chauffants.

• ATTENTION : les parties accessibles peuvent devenir très chaudes quand le four est en marche. Les enfants doivent être tenus à une distance de sécurité.

• Cet appareil n'est pas destiné à être utilisé par des personnes (y compris les enfants) dont les capacités physiques, sensorielles ou mentales sont réduites, ou ayant un manque d'expérience et de connaissances, à moins qu'elles n'aient été formées à l'utilisation de l'appareil, par une personne responsable de leursécurité.

• Lesenfants nedoivent joueravec l'appareil.

• Le nettoyage et l'entretien par l'utilisateur ne doit pas être faitpar des enfantssans surveillance.

• En cours d'utilisation l'appareil devient chaud. Des précautions doivent être prises pour éviter de toucher les éléments chauds à l'intérieur du four. AVERTISSEMENT: Les parties accessibles peuvent devenir chaudes pendant l'utilisation. Les jeunes enfants doivent être tenus à l'écart.

• Ne pas utiliser de nettoyants abrasifs ou de racloirs métalliques tranchants pour nettoyer la vitre de la porte du four car ils peuvent rayer la surface, entrainantdes risques d'explosion.

•Le four doit être éteint avant d'enlever la protection et après le nettoyage, la protection doit être replacé en respectant lesinstructions.

• Utiliser seulement la sonde de température recommandée pour ce four.

• Ne pas utiliser de nettoyants vapeur pour le nettoyage.

• Brancher le câble d’alimentation sur une prise de courant qui supporte le voltage ; le courant et la charge sont indiqués sur l’étiquette ; vérifier la présence d’une mise à la terre. La prise d’alimentation doit supporter la charge indiquée sur l’étiquette et être dotée d’une mise à la terre en état de fonctionnement. Le conducteur de mise à la terre est jaune et vert. Cette opération doit être exécutée

FR 22

par du personnel qualifié. En cas d’incompatibilité entre la prise d’alimentation et la fiche du câble de l’appareil, demander à un électricien professionnel de remplacerla prise d’alimentation par un dispositif compatible. La fiche du câble d’alimentation et la prise d’alimentation doivent être conformes aux normes en vigueur dans le pays d’installation. Il est possible de brancher l’appareil à la prise d’alimentation en installant un disjoncteur multipolaire qui supporte la charge électrique maximale, conformément aux lois en vigueur, entre l’appareil et la prise d’alimentation. Le conducteur jaune et vert de mise à la terre ne doit pas être bloqué par le disjoncteur. La prise d’alimentation ou le disjoncteur multipolaire utilisé pour le branchement doit rester à tout moment accessible lors de l’installation de l’appareil.

•Le débranchement doit se faire en accédant à la prise d’alimentation ou en prévoyant un interrupteur sur le circuit électrique fixe, conforme aux normesélectriques.

•Si le câble d’alimentation est endommagé, il doit être remplacé par un câble ou un faisceau de câbles spécial disponible auprès du fabriquant ou en contactant le service après-vente.

•Le câble d’alimentation requisest leH05V2V2-F.

•Le non-respect des consignes ci-dessus peut compromettre la sécurité de l’appareil et annuler la garantie.

•Tout produit déversé en quantité doit être éliminé avant le nettoyage.

•Pendant le nettoyage à pyrolyse, les surfaces peuvent devenir beaucoup plus chaude que d’habitude, les enfants doivent donc être tenus à une distance de sécurité.

•Ne pas installer l’appareil derrière une porte décorative,pour éviter la surchauffe.

•En introduisant le plateau dans le four, s’assurer que le stop est dirigé vers le haut et au fond de la cavité. Le plateau doit complètement être inséré dans la cavité

• AVERTISSEMENT : Ne tapissez pas les parois du four avec du papier aluminium ou un autre matériau de protection jetable en vente dans le commerce. Tout papier aluminium ou autre matériau de protection qui entrerait au contact direct de l'émail chaud risquerait de fondre et de détériorer l'émail intérieur du four.

• AVERTISSEMENT : Ne retirez jamais le joint de la porte du four.

• Aucun réglage/opération supplémentaire n’est requis pour faire fonctionner l’appareil aux fréquences nominales

SOMMAIRE

Instructions Générales

Description du produit

Utilisation du Four

1.1 Indications de sécurité

1.2 Sécurité électrique

1.3 Recommandations

1.4 Installation

1.5 La gestion des déchets et la protection de l'environnement

1.6 Déclaration de conformité

2.1 Vue d'ensemble

2.2 Accessoires

2.3 Première utilisation

3.1 Description de l'affichage

3.2 Mode de cuisson

Nettoyage du four et maintenance

Dépannage

4.1 Remarques générales concernant le nettoyage

4.2 Fonction

Hydro Easy Clean

4.3 Entretien

• Retrait et nettoyagedes grilles

• Retrait de la porte du four

• Retrait et nettoyage des vitres

• Remplacement de l'ampoule

5.1 F.A.Q.

FR 23

1. Instructions générales

Nous vous remercionsd'avoirchoisiunde nos produits. Pourobtenirlesmeilleursrésultatsavecvotre four, vous devez lire attentivement ce manuel et le conserver pour toute consultation ultérieure. Avant d'installer le four, notez le numéro de série, il vous sera demandé par le support technique si des réparations sont nécessaires. Après avoirenlevé le four de son emballage, vérifiez qu'il n'a pas été endommagé pendant le transport. Si vous avez des doutes,ne pas utiliserle four et seréférer à untechnicienqualifié pour obtenirdes conseils. Conservez tous les matériaux d'emballage (sacs en plastique, polystyrène, clous) hors de la portée des enfants.Lors de la première utilisation du four, il peut se produire un dégagement de fumée âcre provoqué par le premier échauffementdelacolledespanneauxd’isolationenveloppantlefour. Cephénomèneestnormal.Attendez que la fumée cesse avant de cuire des aliments. Le fabricant décline toute responsabilité dans les cas où les instructionscontenuesdansleprésent documentnesontpas respectées.

REMARQUE: les fonctions du four, lespropriétés et les accessoires citésdans ce manuelpeuventvarierselonles modèles.

1.1 Indications de sécurité

Utilisez uniquement le four à sa destination, qui est seulement pour la cuisson des aliments; toute autre utilisation, par exemple comme une source de chaleur, est considérée comme impropre et donc . Le fabricant ne peut être tenu responsabledetoutdommageliéàunemauvaiseutilisationoua des modificationstechniquesduproduit.

L'utilisation de tout appareil électrique implique le respect de certaines règles fondamentales:

dangereuse

1.2 Sécurité électrique

LE BRANCHEMENT ELECTRIQUE DOIT ÊTRE REALISE PAR UN INSTALLATEUR AGREEOUUNTECHNICIENDE E.QUALIFICATION SIMILAIR

L'alimentation électrique àlaquellele four est connecté doit être conforme aux lois en vigueur dans le pays d'installation. Le fabricant décline toute responsabilitépourtoutdommagecauséparlenonrespectdeces instructions. Le four doit être raccordé à l'alimentation électrique avec une prise murale reliée à la terre ou par l'intermédiaire d'un dispositif à coupure omnipolaire, selon les lois en vigueur dans le pays d'installation. L'alimentation électrique doit être protégéepardesfusibles appropriéset les câbles utilisés doiventavoir une section transversalequi peutassurerunealimentation normaledufour.

CONNEXION

Le four est livréavec un câble d’alimentation permettantle raccordement sous une tension électrique de 230 V entre les phases ou entre phase et neutre. Le raccordementdevra êtreeffectué après avoirvérifié:

- Ne pas tirersurlefilélectriquepourdébrancherla prise.

- Ne pas toucherl'appareilavecles mainsoulespiedsmouillésouhumides;

- En général l'utilisation d'adaptateurs, de prises multiples et de rallonges est déconseillé;

- En cas de dysfonctionnement et / ou de mauvais fonctionnement, éteindre l'appareiletnepasytoucher.

- La tensiond'alimentationindiquée surlecompteur;

- Le réglagedudisjoncteur. Le fil de protection du cordon (vert/jaune) relié à la Borne Terre de l’appareil

doit êtrereliéàlaBorneTerre del’installation.

ATTENTION

Faire vérifier la continuité de la terre de l’installation avant de procéder au raccordement. Le fabricant décline toute responsabilité en cas d'accidents ou d'autres problèmes quipourraient survenir à l'usaged'unappareilnon relié àla terre,oureliéàuneterre dontlacontinuité seraitdéfectueuse.

REMARQUE: Le four peut nécessiter une opération de S.A.V. Aussi, placez la prise de courant de façon à pouvoir brancher le four une fois sorti de sa niche. Câble d'alimentation: si le changement du câble d'alimentation s'avère nécessaire, nous vous demandons de faire réaliser cette opération par le service après-venteouunepersonne dequalificationsimilaire.

1.3 Recommandations

Après chaque utilisation du four, réaliser un petit entretien qui favorisera le nettoyage parfait dufour. Ne pas tapisserles parois du fouravec des feuillesen aluminium oudes protections jetables du commerce. La feuille d'aluminium ou toute autreprotection, en contact direct avec l'émail chauffé, risque de fondre et dedétériorer l'émail du moufle.Avant installationdel'appareil,il fautrelever le numéro de série et le noter ci-dessous en cas d'éventuelle demande d'intervention.

Afin d'éviter les salissures excessivesdevotrefourainsique les fortesodeursde fumée pouvant enrésulter, nous recommandonsde ne pas utiliser lefour àtrop fortetempérature. Ilestpréférable de

rallonger le temps de cuisson et de baisser la température. Nous vous conseillons de n'utiliser que des plats, des moules à pâtisserie résistants à de trèshautestempératures.

1.4 Installation

La mise en service de l’appareil està lachargede l’acheteur, le constructeur est dégagéde ce service.Lespannesliéesà une mauvaise installationneserontpas couvertes par la garantie. Une mauvaise installation peut provoquer des dommages aux personnes, aux animaux domestiques; dans ce cas la responsabilité duconstructeurne peut êtreengagée.L'installationdu four doit être réalisée par un installateur agréé ou un technicien de qualification

similaire.Lefourpeutêtreplacéenhauteurdans unecolonneouenchâssésous un plan de travail. Avant sa fixation: il est indispensable d'assurer une bonne aérationdanslaniched'encastrement afindepermettre labonnecirculationde l'air fraisnécessaireaurefroidissement età laprotectiondes organesintérieurs. Pour cela, réaliser les ouvertures spécifiées selon le type d'encastrement (dernièrepage).

1.5 La gestion des déchets et la protection de l'environnement

Le présent appareil est marqué conformément à la directive 2012/19/UE relative aux déchets d'équipements électriques et électroniques

(DEEE). Les DEEE contiennent à la fois des substances polluantes (qui peuvent avoir des conséquences négatives sur l'environnement) et des éléments de base (réutilisables). Il est

importantdesoumettreles DEEEàdestraitementsspécifiques, en vue d'extraire et d'éliminer de façon appropriée toutes les substances polluantes,puisderécupéreret recyclertousles matériaux.

Chacun peut jouerun rôleimportant quant à laprotection de l'environnement contre les DEEE. Pour atteindre cet objectif, il est impératif de suivre quelques règlesélémentaires:

• Les DEEE nedoiventpasêtretraités commedesdéchets ménagers.

• Ils doivent être remis aux points de collecte appropriés gérés par la municipalité ou par des sociétés immatriculées. Dans plusieurs pays, il est

possible de collecteràdomicilelesDEEEvolumineux.

• Lorsque vous achetez un nouvel appareil, vous devez retourner l'ancien au vendeur qui le récupère gratuitement, au cas par cas, à condition que l'équipement soitde type équivalent et possèdeles mêmes fonctionsque celui fourni.

ÉCONOMIEETRESPECTDEL'ENVIRONNEMENT

Lorsque cela est possible, éviter le préchauffage du four et éviter de le faire tourner àvide. N'ouvrez la porte du four que lorsque cela est nécessaire, car ily a desdéperditionsdechaleur à chaquefoisqu'ilestouvert.Pourune économie d'énergie significative, éteindre le four entre 5 et 10 minutes avant la fin de cuisson prévue, et utiliserlachaleur que lefourcontinuedegénérer. Gardez les joints propres et en bon état, pour éviter toute déperdition d'énergie. Si vous avez un contrat électrique avec un tarif heure creuse, le programme "cuisson différée" peut vous faire réaliser des économies d'énergie en déplaçant le début du programmeàunintervalle detempsà tarifréduit.

FR 24

1.6 Declaration De Conformité

alimentairessontconformes àla prescriptiondelaDir. CEE89/109. En utilisant le symbol sur ce produit, nous déclarons sur notre propre

responsabilité que ce produit est conforme à toutes les normes Européennes relativesàlasécurité,la santéetàl’environnement.

2. Description du produit

2.1. Vue d'ensemble

Aveccela,legroupeCandyHoover déclarequecetappareilportant lamarqueLes parties de cet appareil pouvant être en contact avec des substances

estconformeauxexigences essentiellesdeladirective 2014/53/UE.

Pour recevoir une copie de la déclaration de conformité, veuillez contacter le fabricantàl'adressesuivante: www.candy-group.com.

2.2 Accessoires (Selon le modèle)

Léchefrite

1. Panneau de contrôle

2. Positions d'étagère (grille latérale si incluse)

3. grille métallique

4. égouttoir

5. Ventilateur (derrière la plaque d'acier)

6. porte du four

Grilles de fil latéral

Alimentairerecueillelesgouttes pendantlacuissonsurlegril.

Grille métalique

La grille métalique sert de support aux plats.

Grille fil latéral si inclus.

2.3 Première Utilisation

UN PREMIER NETTOYAGE doit être réalisé avant la première utilisation passer un chiffon doux et humide sur les surfaces extérieures de l'appareil. Nettoyer avec une éponge additionnée de produit lessiviel, les accessoires et l'intérieur du four. Rincer et sécher. Faire chauffer le fourà vide une bonne heureàla températuremaximalepour fairedisparaître l'odeurduneuf. Pendantcetteopération, bienaérerlapièce.

FR 25

3. Utilisation du Four (Selon le modèle)

3.1 Description de l'affichage

1. Bouton sélecteur de thermostat

2. Témoin de thermostat

3. Fin de la cuisine

4. temps de cuisson

5. Affichage de la température ou de l'horloge

6. Commandes de réglage de l'affichage LCD

7. Minuteur

8. Réglage de l'horloge

ATTENTION: la première opération à exécuter après l'installation ou après une coupure de courant (de telles situations se reconnaissent parceque leatticheur est sur et clignote)est réglage de l'heure, comme décrit ci-dessus temps ( ).

•Réglerl'heureàl'aidedesboutons ."-" "+"

• AppuyezsurlatoucheMenuouattendez5"quel’horlogesoitconfigurée.

ATTENTION: Lefourfonctionneuniquement sil'horlogeestréglée.

9. lampe de signalisation Wifi

10. Bouton sélecteur de fonction

FONCTION COMMENT L’ARRETER

SECURITE

ENFANT

MINUTEUR

TEMPS

CUISSON

COMMENT L’UTILISER

• La fonction de verrouillage parental estactivéelorsquele fourest éteinten touchant Set (+) pendant au moins 5 secondes. A partir de ce moment, toutes les autres fonctions sont verrouillées et l'affichage clignotera à intervalles de 3 secondes. STOP et le tempspréréglépar intermittence.

•Appuyer1foisur latouchecentrale.

•Appuyer sur les touches "-"ou "+" pour réglerladureé

•Relâcherlestouches.

• Sélectionnez la fonction de cuisson avec le bouton de fonction du four, ainsi que la température de votre choix avecle boutonduthermostat.

•Appuyer fois sur la touche centrale.

•Appuyer sur les touches "-" ou "+" pour réglerladurée.

•Relâcherlestouches

•Choisir lafonctiondecuissonavecle boutondesélection. REMARQUE: Si lefour est éteintou si la lampe fonctionne, la fonction de programmation du temps de cuisson ne fonctionnepas.

• La fonction de verrouillage enfant est désactivée avec le four éteint en touchant ànouveaulepavé tactileSet (+) pendant au moins 5 secondes. A partir de ce moment, toutes les fonctions sont sélectionnables à nouveau.

•A la fin de la durée sélectionnée, le minuteur secoupeetunsignalsonore retentit il s'arrête automatique ment, mais pour le topper de suite, appuyer surla touche

•Pour arrêter le signal, appuyer sur l'une des touches au choix. Appuyer sur latouche centrale pour retourneràla fonctionhorloge. Réglez lesélecteurdefonctionsur "0" pour

BUT

•Emission d'un signal sonore à la fin d'un tempssélectionné

•Durant l'utilisation, l'écran affiche le tempsrestant.

•S.électionner la durée de la cuisson des alimentesdansle four

•

Pour visualiser le temps restant

appuyerlatouche .

•

Pour modifier le temps restant

appuyerlatouche + ou

12:00

. Le voyant LED en bas à droite clignote en même

REMARQUE

•II permetd' program-mateurdu four utilisé avecle fouralluméou éteint).

• À la fin du programme, le programme émet 3 signaux d’avertissement et le message End(Fin)apparaît surl’afficheur.

SELECT

reveniràla fonctionhorloge.

SELECT "-" “+"

utiliser le

comme unrêveilmémoire (il peut être

HEURE DE

FIN DE

CUISSON

• Sélectionnez la fonction de cuisson avec le bouton de fonction du four, ainsi que la température de votre choix avecle boutonduthermostat.

•Appuyer sur les touches "-"ou "+" pour régler duréela

•Relâcherlestouches

• e cuissonavecle

Choisir lafonctiond boutondesélection REMARQUE: Si lefour est éteintou si la lampe fonctionne, la fonction de programmation du temps de cuisson ne fonctionnepas.

• four

A l'heure sélectionnée le s'éteint tout seul; pour avant il est nécessaire de porter le boutondesélectionen positionO.

l'arrêter en

FR 26

•Mémoriser l'heuredefin decuisson

• 3 foisPourvisualiserl'heure

•

Pour modifier l'heure sélectionnée appuyer sur les touche SELECT "-" "+"

+ou•2 fois

•Cette fonction est utilisée pour des cuissons que l'on peut programmer à l'avance. Par exemple, votre plat doit cuire 45 mn et être prêt à 12:30; réglez alors simplement la durée sur 45 mn et l'heure de findecuissonsur 12:30.

•Quand le temps de cuisson est écoulé, la cuisson s'arrête automati quemen et l'alarme sonne q secondes. La cuisson commencera auto matiquement à 11:45(12:30moins 45 mn)et continuera jusqu'à ceque l'heuredefin de cuissonsoit atteinte. A ce moment, le tour s'arrêtera automatiquement

uelques

FONCTION WI-FI ELETTRONICAZERO

Le Wi-Fi a deuxpositionsdifférentes surle sélecteurdecuisson:

• Wi-Fion: LeWi-Fi n’est allumé que si le four est déjàenregistrésur votre dispositif. Dans cette position, le four sera uniquement commandéàdistance.

• Wi-Fireset: Après avoir laissé le sélecteursurWi-Firesetpendant 30”, leBluetooths’allumera etvouspourrezenregistrer le four sur votredispositifdansles5’. Si l’enregistrement est effectué correctement, le four sera commandé à distance et l’icône Wi-Fi seraallumée. Si l’enregistrement échoue, le Wi-Fi s’éteindra etle foursera réinitialisé. Pourl’enregistrerànouveau,ilfautenlever lesélecteurduprogramme decuissondela positionWi-Firesetpuisleremettre dessus.

Remarque:Installezl’applicationsurvotredispositif avantde commencerl’enregistrement Remarque:LeBluetoothdoit êtreactivésurledispositifoùl’applicationestinstallée Remarque:Pourles deuxpositionsWi-Fi,lestouchestactilesne fonctionnentpas. Remarque:Il est fondamentald’établir unsignalWi-Fi puissant entre le routeur du domicileet l’appareil. Quand le four tentedese

connecteraurouteur, l’icôneclignotependant3” alluméeet1”éteinte;quand ilestdéjàconnecté,l’icône s’allume.

1 2

3 4

HOOVER :

Pour des informations détaillées sur COMMENT CONNECTER votre appareil ONE et COMMENT

L’UTILISERau mieux,visitezlesiteFihttp://wizardservice.candy-hoover.com/

1. Sélection du programme / 2. Durée du programme / 3. Réglage du démarrage de la cuisson / 4. Sélection de recettes dédiées / 5. Assistant vocal et hors ligne / 6. Astuces, suggestions et manuel d'utilisation en ligne

3.2 Mode de cuisson

Bouton de

sélection

T °C

Suggested

180

190

Fonction (selon modèle)

L'AMPOULE: Allumage de l’éclairage du four

DÉCONGÉLATION: fonctionnement de la turbine decuisson quibrassel'air dansl'enceintedu four.Idéale pourréaliser une décongélation avant

une cuisson.

CHALEUR BRASSÉE:fonction recommandéepourlesvolailles,les pâtisseries, les poissons, les légumes... La chaleur pénètremieuxàl'intérieurdu mets à cuire et réduit le temps de cuisson, ainsi que le temps de préchauffage. Vous pouvez réaliser des cuissons combinées avec préparations identiques ou non sur un ou deux gradins. Ce mode de cuisson assure en effet une répartition homogène de la chaleur et ne mélange pas les odeurs.Prévoirune dizainedeminutes deplus,pourlacuisson combinée.

La fonction vouspermetde cuisiner demanière plus saineenréduisantlaquantitédegraisseoud'huilerequise.Grâceàl'utilisationdu gril et du ventilateur combinés à uncycle d'airpulsé, il retient lateneur enhumidité desaliments, grillela surface et réduit le temps de cuisson sans compromettrele goût. Il est particulièrementadapté à lacuissondesviandes,deslégumesgrillésetdesomelettes. Lecycledel'airpulsémaintient l'humiditéàl'intérieur du fouretlateneur eneaudel'aliment, préservantainsiles valeursnutritionnelleset assurantun processusdecuissonrapide etuniforme. Essayez toutes vos recettes et réduisez la quantité de vinaigrette que vous utilisez habituellement et découvrez la légèreté de cette nouvelle fonction!

"ECO"

SOLE BRASSÉE:idéalepour les tartes à fruitsjuteux,lestourtes,les quiches, lespâtés.Elleévitele dessèchement des alimentsetfavorise la levée

210

pour les cuissons de cakes, pâte à pain et autres cuissons par le dessous. Placer la grille sur le gradin inférieur. Avec ce mode de cuisson, un préchauffage est nécessaire en Chaleur Brassée pendant une dizaine de minutes.

CONVECTIONNATURELLE: utilisationsimultanée delarésistance desoleet devoûte. Préchaufferle four une dizainedeminutes.Idéalepourtouteslescuissonsàl'ancienne,poursaisirlesviandesrouges, les rosbifs,gigots,gibiers,le

220

pain, lespapillotes,lesfeuilletages. Placerle metsàcuireà unniveaudegradin moyen.

GRIL: l'utilisation dugrilloir se fait portefermée. Un préchauffage de 5 mins est nécessaire pour le rougissement dela résistance. Succès assuré pour les grillades,lesbrochetteset lesgratins.Les viandes blanchesdoiventêtreécartées dugrilloir;letemps decuissonseraalors pluslong,mais la viande sera plus savoureuse. Les viandes rouges et filets de poissons peuvent être placés sur la grille avec le plat récolte sauce glissé

230

dessous. Le fouradeuxpositions degril:Gril:2140 W Barbecue: 3340W

Turbo-Gril: l'utilisation de la position turbo-gril se fait porte fermée. Un préchauffage est nécessaire pour les viandes rouges et inutile pour les viandes blanches. Idéal pour les cuissons de volume épais, des pièces entières telles que rôti de porc, volailles etc... Placer le mets à cuire

200

directementsurlagrilleaucentredufour, à un niveaumoyen.Glisserlerécolte-saucesous la grille de façon àrécupérerles graisses.S'assurerque le metsnesoitpastrop prèsdugrilloir.Retournerla pièceàcuireà mi-cuisson.

220

* Programme testé selon le CENELEC, norme européenne EN 60350-1 qui définit la classe énergétique.

PIZZA:Aveccettefonction, l'airchaud circuledanslefour pourassurerun résultatparfait pourlesplats telsqueles pizzasoulesgâteaux.

WIFI ON: Le fourpermetla connexionWi-Fi.

WIFI RESET:Permet leredémarrage delaconnexion Wi-Fi.

FR 27

4. Nettoyage du four et maintenance

4.1 Remarques générales sur le nettoyage

Le cyclede vie de l'appareil peutêtre étendu grâce à unnettoyage régulier. Attendezle refroidissement du four avant de procéder àdes opérations de nettoyage manuel. Ne jamais utiliser de détergents abrasifs, de laine d'acier ou d'objets pointus pour le nettoyage, l'émail serait irrémédiablement abîmé. Utilisez uniquement de l'eau, du savon ou des détergentsàbased'eaudeJavel(ammoniac).

PARTIE VITREE

Il est conseillé de nettoyer la vitre avec du papier absorbant après chaque utilisation du four. Pour enlever les taches plus tenaces, vous pouvez utiliser une éponge imbibée de détergent,puisrinceràl'eau.

JOINT DE LA PORTE

Si elle est sale, le joint peut être nettoyé avec une éponge légèrement

4.2 Hydro Easy Clean Fonction

Le systèmeHYDROEASYCLEAN utiliselavapeurpouréliminerlesgraissesetlesrestesde nourrituresincrustéessur lesparoisdufour.

1. Verser300 mld’eau danslazoneprévue àceteffet (aucentre delacavité– voirschéma)

2. Mettreleprogrammeconvection naturelle ( )ousoleseule( ).

3. Mettrelatempératuresur HYDROEASYCLEAN .

4. Laisser agir 30 minutes.

5. Une foisles30 minutesécoulées,éteindreleprogrammeet attendre quelefourrefroidisse.

6. Une foisquelefourestrefroidi passerunlingepropre pouréliminerlesrésidus.

Attention:

Ne pas toucher les paroistantqu’elles n’ont pasrefroidies (risquedebrûlures).N’utiliser quedel’eau potable ou distillée.

humide.

ACCESSOIRES

Nettoyer les accessoires avec une éponge et de l'eau savonneuse puis rincer. Eviter d'utiliserdes détergents abrasifs.

LECHEFRITE

Après l'utilisation de la grille, retirez le du four. Prendre soin de reverser les graisses (tièdes) dans l’évier. Laver et rincer le plat récoltesauce dans del’eau chaude, avec une éponge imbibée de produit lessiviel. Si les résidus restent collés, le faire tremper dans de l’eau et un produit détergent. Il peut aussi être nettoyé dans un lave-vaisselle ou avec un produitducommerce. Ne jamais replacer le platrécolte-sauceencrassédansunfour.

lêchefrite

300 ml

4.3 Entretien

RETRAIT ET NETTOYAGEDESGRILLES

1-Retirezlesgrillesenlestirantvers l’intérieurdu four (voirschéma) 2- Mettezlesgrillesdirectementaulave-vaisselle oulavez-les simplementavec uneépongehumideetveillezàbienlesessuyer. 3-Une foislesgrillesnettoyées,reclipser-les dans lefour (voirschéma)

RETRAIT DE LA PORTE DU FOUR

1. Ouvrezlaporte.

2. Ouvrezlespincesdu boîtier de charnièresurle côtédroitetgauchedelafenêtre avant enlespoussantvers lebas.

3. Replacezlaporteenprocédantensensinverse.

FR 28

LOW-E

RETRAIT ET NETTOYAGEDESVITRES

1. Ouvrezlaportedufour.

2.3.4. Bloquer les charnières, enleverlesvis et retirezlecouverclemétallique supérieurenletirantvers lehaut.

5.6. Retirez leverre, soigneusement de laporte du four (NB: dans lesfoursde pyrolyse, retirezégalementles deuxième ettroisième verre (le cas échéant)).

7. A la fin du nettoyageRemonter lespiècesdansl'ordreinverse. Sur toutes les vitres, l'indication "Pyro" doit être lisible et positionné sur le côté gauche de la porte, à proximité de la charnière latérale gauche. De cette

manière,l'étiquetteimpriméedupremierverresera àl'intérieurdelaporte.

l'extraire

FR 29

REMPLACEMENTDEL'AMPOULE

1. Débranchezlefourdelaprise.

2. Défairelecouvercleen verre,dévisserl'ampouleetlaremplacerparuneampouledumêmemodèle.

3. Une foisl'ampouleremplacée,remettrele couvercleenverre.

5. Dépannage

5.1 FAQ

PROBLEMES CAUSE POSSIBLE SOLUTION

Le four ne chauffe pas

Aucume rèaction de

l'ècran tactile

L'horloge n'est pas réglée Réglez l'horloge

Les réglages nécessaires

ne sont pas imposés

Vapeur et de la condensation

sur l'ècran tactile

Assurez-vous que les paramètres

nécessaires sont corrects

Nettoyer avec un chiffan en microfibres

l'ècran tactile pour enlever la couche de

condensation

FR 30

+ 83 hidden pages