Halcro UTSR1 Owner's Manual

Download

Owner’s Manual

UUnniivveerrssaallTToouucchhSScrcreen

eenRReemmoottee

UTSR1

DDoocckkiinnggSStat

tatioionn

Rev 1.1

820-6110-0008

Table of Contents

UnniivveerrssaallTToouucchhSSccrreeeennRReemmoottee

.................

...................33--2211

Key Features.............................................................. 3

Optional Features ...................................................... 3

Specifications ............................................................. 5

Battery Installation and Charging...............................7

OOppeerraatitinnggtthheeRReemmoottee...............................

...............................

.......

........8.8

Panel Calibration........................................................ 8

Hot Keys..................................................................... 9

Hard Keys................................................................... 9

Key Tone .................................................................... 9

Backlight .................................................................... 10

IR Codes Library........................................................10

Configuration/Setting Up the Unit ........................... 10

AAddvvaanncceeddSSeett--UUpp...............................

...............................

.............

...............1313

Edit ............................................................................. 13

Preference.................................................................15

Remote Setting......................................................... 15

Smart ......................................................................... 18

Clone.........................................................................20

PC Link....................................................................... 21

Interactive Help Screen............................................ 21

DDoocckkiinnggSSttaatitioonn...............................

...............................

..........

............2222--2525

Key Features............................................................ 22

Specifications ........................................................... 22

Quick Charger Function.......................................... 24

Remote Advanced Editing via Computer.............. 24

Maintenance ............................................................25

TTrroouubblleesshhooootitinngg...............................

...............................

.........

...........2626--2277

UTSR1........................................................................ 26

Docking Station........................................................ 27

DDeevviciceeCCooddeeLLiisstt...............................

...............................

........

..........2828--3939

Preamp..................................................................... 28

Surround Sound Processor .................................... 28

TV .............................................................................. 28

SAT/CBL................................................................... 34

CD ............................................................................. 37

DVD........................................................................... 38

SSeerrvvicicee&&WWaarrrraannttyy...............................

...............................

....

......4040--4242

Service Information.................................................. 40

Warranty Information................................................ 41

Warranty Registration Form.................................... 42

YYoouurrHaHallccrrooLLogogiiccUUTTSSRR11inintteeggrraatteessyyoouurrhhoommees

IInfnfrraarreeddrreemmototeeccoonnttrroollss,,totoddeelilivveerrininssttaannttaauuddiioovviissuuaal

acacttiioonn.

KKeeyyFFeeatur

atureess

•

Pre-Programmed with learning capability

•

9-in-1 remote (replace HALCRO dm 8/10, HALCRO SSP, CD, TV, SAT TV, CBL TV, D VD, AUX 1 & AUX2)

•

Learn up to 240 commands

•

EL backlit touch screen panel with intelligent light sensor for power saving

•

5 useful hard keys for direct access ( ,

CCH+

H+

CCH-

H-

VVOOL+

L+

VVOOL-

L-

)

•

3 touch screen shortcuts ( , , )

•

Set up by code entering, device brand name search and library code search

•

10 programmable smarts, each with 32 steps in maximum

•

Device name and function keys editing, moving, deleting and restoring

•

Custom page for personal set up and frequently used commands

•

Remote-to-remote copy function

•

Volume ‘punch through’ control for TV, HALCRO Pre-amplifier and HALCRO SSP

nteractive help screen

•

Security password lock

•

Real time clock

•

Battery level indicator

uto power off C/DC power charger

OOppttiioonanallFFeeatur

atureess

•

Docking Station for quick battery charging

•

Computer link (PC link) for special key layout and function via USB connection to PC

•

Perform PC software upload and download

•

Remote Control

1. Infra-red Lens 6. Touch Screen Panel

2. Green LED Indicator 7. Short Cut Keys

3. Battery Level Meter 8. Hard Keys

4. Current Time 9. Connection Jack

5. Current Mode 10. Battery Compartment

2 3

Spe

Specciiffii

cat

catiioonnss

•

Operation System: Integrated preprogrammed

and learning infra-red remote control system

•

Compatibility: Preprogrammed with code

library of HALCRO dm 8/10 (Preamplifier), HALCRO SSP, Compact Disc

Players

(CDs), Televisions

(TVs),

Satellite/Digital

Satellite

Receivers (SAT

TVs), Cable

Converters

(CBL TVs) and

Digital Video

Disc Players

(DVDs)

•

Memory Capacity: 240 learning commands

•

Memory retention after battery disconnection:

Non-volatile and permanent memory

•

Display Panel: Monochrome touch screen

LCD

•

Resolution: 320 x 80 pixels

•

EL Backlighting: Blue-Green EL backlighting

with light sensor

•

Operating Distance: 8 Meters (25 feet)

•

Power Requirement: 4 x AAA size NiMH

rechargeable batteries

•

Charging Time: Approximately 17 hours

•

Dimensions: 220 x 51 x 25 mm

•

Weight: 165g (without batteries),

215g (with batteries)

•

ncluded Accessories: AC/DC power adaptor

(DC9V, 400mA, 3.6VA) x 1, Connector x 1 (for charging purpose), 4 x AAA size NiMH rechargeable batteries

•

Optional Accessories: Halcro Logic Docking

Station – Quick charger, PC Link software for MS Windows 98SE, Windows 2000, Windows NT, Windows XP and USB Cable

Remote Control

Note: Both the Halcro Logic UTSR1 and Docking

Station comply with limits for a Class B digital device,

pursuant to Part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This

equipment generates, uses and can radiate radio

frequency energy and, if not installed and used in accordance with the instruction, may cause harmful interference to radio communications. However, this is no guarantee that interference will not occur in a particular installation.

If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures:

•

Reorient or relocate the receiving antenna

•

Increase the separation between the equipment and receiver

•

Connect the equipment into an outlet on a circuit different from that to which the receiver is connected

•

Consult the dealer or an experienced radio/TV technician for help

may void users authority to operate this device”

“Modifications not authorized by the manufacturer

BBatt

atteerryyIInnsstatallllatatiioonnananddCC

har

harggiinngg

Your Halcro Logic UTSR1 is supplied with 4 x AAA NiMH rechargeable batteries, a connector and a charging adaptor. We recommend you charge your batteries over night (10 hours) before 1

time use.

The battery meter (top-left corner of LCD) will empty to indicate when the batteries require recharging.

To install the batteries, open the battery cover; follow the polarity symbol shown in battery compartment, place the batteries inside and then replace the cover.

To recharge batteries, put the power adaptor into AC wall outlet, insert the DC jack to the connector, then connect to the socket at the bottom of the remote. It takes approximately 14 to 16 hours to fully charge the batteries.

Note: The Battery icon is not shown when in Menu mode. The unit is designed for optimum operation with original batteries.

Do NOT connect charging adaptor and connector when using the non-original batteries. To avoid data loss, Do NOT attempt remote setup when batteries are weak.

Remote Control

OOpeperarattiinnggtthheeRReemmootte

After inserting the batteries, you will be prompted by the main page, which shows all the devices and functions for selection.

•

Tap HHOOMMEEat any time to jump to this page. If remote is inactive for approximately 60 seconds, it will go to sleep mode and shut down the display. Simply touch the screen panel to activate the unit. (Note: When in sleep mode, the hard key section is still available for command)

•

Tap any device icon on screen to enter corresponding device mode. The LCD shows a remote key platform

•

Tap a key directly to send out corresponding infrared command

•

Tap PPAGE

AGE

at bottom of screen to change

command pages

•

Tap HHOOMMEEto return to main page

•

There will be no label or symbol for an empty key (Note: these keys are available for learning, please refer to learning section of this manual for details.)

•

Tap MMEENUNUto set up the unit

Panel Calibration

Please follow the below instruction for calibration of the Halcro Logic UTSR1. If you experience any incorrect response from the touch screen, please recalibrate the unit.

•

Tap MMEENNUUto set up the unit

•

Tap RREEMMOOTTEESSEETTTTIING

•

Tap CCAALLIIBRBRAATTION

ION

•

Follow the described procedure from the screen display

•

Tap BBAACKCKto go back to the HHOOMEMEpage

Note: If your Halcro Logic UTSR1 does not respond, you can reset the remote by pressing the

RREESSET

key inside the battery compartment (see illustration). This product may need to be manually reset under high electrostatic discharge.

HHoottKKeeys

There are 3 Hot keys on the bottom of LCD display,

•

HHOOMEMEJump to main page

•

MMEENUNUAccess main setup menu for

configuration/setting

•

MMUUTETEVolume mute function

HHararddKKeeys

There are 5 hard keys that transmit IR command corresponding to device selected.

•

Power ON/OFF

•

CCH+

H+

Program up or Channel up

•

CCH-

H-

Program down or Channel down

•

VVOOL+

L+

Volume up

•

VVOOL-

L-

Volume down

KKeeyyTToonne

When you tap any key, there is a short audible beep. User can enable/disable this function from main menu setting (for details, please refer to R

ReemmototeeSSeetttt

ing

section in this manual.)

Remote Control

BBacackkliligghht

There are two separate EL backlights for LCD screen and hard keys, and will be turned ON separately. Backlight will be turned ON for 5 seconds (factory default setting) after a key is pressed, and user can disable this function. (For details, please refer to R

ReemmototeeSSeetttt

ing

section in this manual.)

IRIRCCode

odessLLiibb

rar

raryy

To setup a code, tap MMEENUNUonce then select a device to setup, choose a setup method. User can setup by learning key command from an original remote control, entering a code number, browsing through brand name list, or searching through the whole library. Refer to separate Code List for IR code number of different device.

CCoonnffiiggura

urattiioonn

/Se

/SettttiinnggUUpptthheeUUnniitt

Tap MMeenunu, then choose any one of the following items:

Seettuupp––

setup the pre-programmed code or learn key

command.

•

Tap SSEETTUPUPfrommainmenu

•

Select one of following setup methods

LLeeaarrnniing

– learn or copy a key command from an

original remote control to Halcro Logic UTSR1

•

Tap LLeeaarrning

ning

from Setup menu

•

Select a device where you would like to carry the command keys (e.g. TV)

•

Tap a key to be learnt from the Halcro Logic UTSR1

•

im an original remote to the front of Halcro Logic UTSR1. Press and hold the key until Halcro Logic UTSR1 responds with a successful message (approx. 5 seconds)

•

Edit the keyname or just tap OKOKto confirm

•

Tap another key to continue learning of the rest of the useful commands

•

Tap MMEENUNUto return to main menu, or tap

OME

to return to main page

Dual

Signal

Learning

– If you find that a Learn command only works occasionally for your audiovisual equipment, your original remote control mayay contain dual signals. Please follow the below steps to reprogram these commands.

•

Tap LLeeaarrning

ning

from Setup menu

•

Select a device which you would like to carry the command keys (e.g. TV)

•

Tap a key to be learnt from the Halcro Logic UTSR1

•

the original remote to the front of the Halcro Logic UTSR1. Press and hold the key until Halcro Logic UTSR1 responds with a successful message (approx. 5 seconds)

•

Edit the key name or just tap OKOKto confirm

•

Tap the same key on the Halcro Logic UTSR1 Again aim the original remote to the front of the Halcro Logic UTSR1. Press and hold the same key until Halcro Logic UTSR1 responds with a successful message

•

Edit the key name or just tap OKOKto confirm

Note: The optimum receiving distance is 5 to 8cm for remote learning. If you have any reported problem during the learning process, adjust the distance and try again.

Brand

Name

– setup pre-programmed code by

selecting a brand name.

•

Turn on your device you wish to install before start this setup procedure. (e.g. TV)

•

Tap BBrraannddNaNamemefrom Setup menu

•

Select a device (e.g. TV)

•

brand name list in alphabetical order will be displayed. Tap or to browse the list, or tap a character to access to a brand name. (e.g. ‘H’ for Halcro)

•

Tap a brand name from the list, it will be highlighted (e.g. Halcro)

Aim

•

5-8 cm

Remote Control

•

Tap test keys on LCD screen or any of hard keys to test the selected code

•

Tap to search next code, or command will be sent at the same time

•

Tap to skip previous code

•

Tap Back

Back

to cancel and return to previous menu page for selection of other brand name. (Follow the above steps again)

•

Tap OKOKto confirm and exit the setup

Note: If you have reached the end of code, you will be

prompted to continue for

AAuutoto--SSeeaarrch

EExxitit.

For

details of Auto-Search setup, please refer to Auto-

Search Setup section in this manual.

EEnntteerrCCode

ode

– setup pre-programmed code by entering code number. (Halcro Logic UTSR1 is preloaded with numerous control codes for most popular AV equipment; you can refer to the enclosed code list for your devices.)

•

Tap EEnntteerrCCode

ode

from Setup menu

•

Select a device (e.g. TV)

•

Tap numeric digit to enter code number (check your code from the code list, e.g. 0021)

•

Tap DeDelleeteteto delete the last entered digit (if you have mistyped a number)

•

Tap Back

Back

to cancel and return to previous menu

page

•

Tap OKOKto confirm the input

•

Tap TTeessttKKeyeyon LCD screen or any of hard key to test the corresponding function

•

Tap OOKKto confirm and exit the setup

AAuuttooSSeeaarrch

- setup pre-programmed code by

searching through the library.

•

Turn on your device before starting this setup procedure (e.g. TV)

•

Tap AAuutotoSSeeaarrchchfrom Setup menu

•

Select a device (e.g. TV)

•

Tap once and then repeat until your device is switched off. Then, press OK

to save the code. Or

you can tap the T

TEESTST

key to test the device during

setup

If you have missed the last code, tap once to skip backward

•

Tap Back

Back

to cancel and return to previous menu

page

•

Tap OKOKto confirm and exit the setup

Note: When a code is set to a device, the learned command and key name of that device will be lost, and restored to pre-programmed command. Some codes do not have Power command. These codes may not be detected by using Auto-Search. User is advised to use

TTeest

key to test other keys. During auto-searching, user can access any of the hard keys to test the command.

AAddvvanc

ancededSeSett--UUpp

EEddiit

This function allows you to rename, move or delete key/device label.

Tap M

MEENUNU

then tap EEDDITITand choose any one of

the following items:

KKeeyyNNaame

- rename key label

•

Tap KKEYEYNNAAMEMEfrom Edit menu

•

Select a device

•

Select a key to be edited

•

Tap , , or for quick access to different groups of keys (Character, Symbol or Graphic), and tap or to access different pages of each group of keys

•

Tap a character/symbol/graphic from the page

•

Tap DDEELLEETETEto erase last entered character/symbol/graphic

•

Tap BBAACKCKto ignore and return to previous page

•

Tap OKOKto confirm and exit editing

Note: The number of characters input depends on the

corresponding key size

•

ABC ?!À

Remote Control

DeevviciceeNNaameme

--rename device label

•

Tap DDEVEVIICECENNAAMEMEfrom Edit menu

•

Select a device

•

Tap , , or for quick access to different groups of keys (Character, Symbol or Graphic), and tap or to access different pages of each group of keys

•

Tap a character/symbol/graphic from the page

•

Tap DDEELLEETETEto erase last entered character/symbo /graphic

•

Tap BBAACKCKto ignore and return to previous page

•

Tap OKOKto confirm and exit editing

Note: Maximum input of 7 characters

MMoovveeKKey

- move key location (exchange keys

position)

•

Tap MMOOVEVEKKEYEYfrom Edit menu

•

Select a device

•

Select a key to be moved, tap OKOKto confirm

•

Select a destination, tap OKOKto confirm. The position of the 2 selected keys will then be exchanged

•

Select a key to continue or tap MMEENUNUto exit Move Key mode and return to main menu

MMoovveeDDeevvice

ice

– move device location

•

Tap MMOOVEVEDDEVEVIICECEfrom Edit menu

•

Select a device to move, tap OKOKto confirm

•

Select a destination, tap OKOKto confirm. The position of the 2 selected devices will then be exchanged

•

Select a device to continue or tap MMEENUNUto exit Move Device mode and return to main menu

DDeelleetteeKKey

– delete a key

•

Tap DeDelleetteeKKeyeyfrom Edit menu

•

Select a device

•

Select a key to be deleted, tap YES

YES

to confirm

•

Select a key to continue or tap MMEENUNUto exit Delete Key mode and return to main menu

ABC ?!À

PPrreeffeerreencnce

Tap MMEENNUUthen tap PPRREEFFEERREENNCECEand choose any one of the following items:

PununcchhThThrroouugghh

– set up device punch through for

Volume Control, Volume + / - and Mute.

•

Tap PPUUNNCCHHTTHHRROOUUGHGHfrom Preference menu

•

Select a source device (e.g. HALCRO dm 8/10)

•

Select a target device (e.g. DVD)

Note: For punch through, Vol +, Vol - and Mute will be punched through to the selected device.

CuCusstotommPPaaggee––set up a user custom page

•

Tap CCUUSSTTOOMMPPAGE

AGE

from Preference menu

•

Select your keys from different devices for custom page

•

Select a device where a key to be copied to custom page (e.g. TV)

•

Select a key command to be copied to custom page (e.g. )

•

Tap YES

YES

to confirm the selection

•

Tap to select other key to create new command or tap M

MEENUNU

to exit and return to main menu

Note: Custom Page is a group of keys that allow the user to copy key commands from different devices, access custom pages from the

HHOOMME

page, view the

device attribute of a key (tap the header

CCUUSSTTOOM

PPAGE

AGE

once to toggle display device name and key name) and if a key is deleted or re-named on original device, it is also changed in Custom Page.

RReemmootteeSeSettttiinng

Tap MMEENNUUthen tap RREEMMOOTTEESSEETTTTIINGNGand choose any one of the following items:

Cloocckk

– adjust clock

•

CuCurrrreennttTTimimee– adjust current time

•

Tap ClCloockckfrom Remote Setting menu

•

Tap SSetetto adjust clock

•

Enter four digits, first two digits represent hour and second two digits represent minutes (24 hour format is used.)

•

Tap OKOKto confirm and exit the setting

Remote Control

•

DDaayyooffWWeek

eek––

adjust day of week

•

Tap ClCloockckfrom Remote Setting menu

•

Tap SSetetto adjust date

•

Tap or to select day of week

•

Tap OKOKto confirm and exit the setting

BeeeeppSoSounundd

– turn beep sound On/Off

•

Tap BBeep

eepSoSo

und

from Remote Setting menu

•

Tap EEnnaabbleleto turn on beep sound

•

Tap DDiissaabbleleto turn off beep sound

LCDCD

– set up LCD related function

•

LLiigghhttAAuutotoOOffff: select backlight auto turn off at 5 Sec, 10 Sec or 15 Sec

•

Bac

BackkliligghhttCCoonnttrrolol

select an option of backlight control method, By Sensor, Always On or Always Off.

Paasssswwoorrdd

- create/enable or disable password In order to keep your personal setting of the Halcro Logic UTSR1 secure, you can activate the password function for remote setting protection.

•

Enter password, max. 5 characters

•

Re-enter password for confirmation

•

Tap DDEELLEETETEto delete last character

•

To disable password, give a blank input (no characters) to password field

Note: Universal password is

AAAAA

RReesseettDDefefaauult

– reset user setting to factory default.

Warning: Please make sure it is necessary to perform

this function. Your Halcro Logic UTSR1 will be reset to

factory pre-loaded setting and all the learned signals/custom setting will be erased.

ClCleeaarrLLeeaarrning

ning

– to clear learned command and

restore keys to default command.

One Key – to clear learned command and restore keys to default command

•

Tap to select a device

•

Tap to select a key

•

Tap YYesesto confirm or tap NoNoto abort

One Device – clear learned command of all keys of a device.

•

Tap to select a device

•

Tap YYesesto confirm or tap NoNoto abort

All Devices - clear all learned commands of all devices.

•

Tap AAllllDeDevviicces

•

Tap YYesesto confirm or tap NoNoto abort

KeeyyRReennaameme

– clear user renamed key label and

restore to factory default.

One Key – single

key.

•

Tap to select a device

•

Tap to select a key

•

Tap YYesesto confirm or tap NoNoto abort

One Device – restore all user renamed key label of a device.

•

Tap to select a device

•

Tap YYesesto confirm or tap NoNoto abort

All Devices - restore all user renamed key label of all devices.

•

Tap AAllllDeDevviicces

•

Tap YYesesto confirm or tap NoNoto abort

DevviicceeRReennaameme

– clear user renamed device label

and restore to factory default.

One Device - restore a single user renamed device label and restore to factory default.

•

Tap to select a device

•

Tap YYesesto confirm or tap NoNoto abort

All Devices - restore all user renamed device label and restore to factory default.

•

Tap AAllllDeDevviicces

•

Tap YYesesto confirm or tap NoNoto abort

MoovveeKKeyey

– clear and restore user setting about key

movement.

One Device – clear the setting of key movement of a device and restore to factory default.

•

Tap to select a device

restore user renamed key label of a

Remote Control

•

Tap YYesesto confirm or tap NoNoto abort

All Devices - clear all settings of key movement of all devices and restore to factory default.

•

Tap AAllllDeDevviicces

•

Tap YYesesto confirm or tap NoNoto abort

MoovveeDeDevviicece

- clear the setting of device movement

and restore to factory default.

•

Tap MMoovveeDeDevviicces

•

Tap YYesesto confirm or tap NoNoto abort

DelleetteeddKKeyey

– restore deleted keys.

One Key – restore a single deleted key

•

Tap to select a device

•

Tap to select a key

•

Tap YYesesto confirm or tap NoNoto abort

One Device – restore all deleted keys of a device.

•

Tap to select a device

•

Tap YYesesto confirm or tap NoNoto abort

All Devices – restore all deleted keys of all devices.

•

Tap AAllllDeDevviicces

•

Tap YYesesto confirm or tap NoNoto abort

AllllTTooDeDeffaa

ult

– restore all user settings to factory

default.

•

Tap YYesesto confirm or tap NoNoto abort

Note: All user settings will be lost (except clock and password). Default function do not clear clock setting and password.

SSttaattus

– show information of the unit.

•

Display software version, code number of each device and other useful information

•

Tap or for more information or tap Back

Back

return to R

ReemmototeeSSeetttt

ing

SSmmart

art

Halcro Logic UTSR1 comes with 10 editable SSMMAART

programs each with a maximum 32 key steps. With the help of S

SMMAARTRT

, you can program a group of commands and time delay to execute in a chain of IR signals simply by the press of SMART button.

Tap MMEENUNU, then tap SSmmaartrtand choose any one of the following items:

AddddNNeewwSSmmaarrtt

– create a new smart command.

•

Select an empty smart key

•

Tap AADDDDKKEYEYto select a device and a key to add it into smart list

•

Tap AADDDDDDEELLAAYYto add a delay time between key command (maximum delay is 20 seconds)

•

Select an item from the command list and tap M

MOOVEVEUPUP

and MMOOVEVEDDOOWNWNto re-order the

sequence of that item, or tap D

DEELLEETETE

to remove

that item from the list

•

Tap TTEESTSTto test the function of Smart

•

Tap OKOKto confirm

EddiittSSmmaarrtt

– edit an existing smart key

•

Select an existing smart

•

Tap AADDDDKKEYEYto select a device and a key to add it into smart list

•

Tap AADDDDDDEELLAAYYto add a delay time between key command (maximum delay is 20 seconds)

•

Select an item from the command list and tap M

MOOVEVEUPUP

and MMOOVEVEDDOOWNWNto re-order the

sequence of that item, or tap D

DEELLEETETE

to remove

that item from the list

•

Tap TTEESSTTto test the function of Smart

•

Tap OKOKto confirm

DelleetteeSSmmaarrtt

– delete a smart key

•

Select an existing smart

•

Tap OKOKto confirm

•

Tap BBAACKCKto abort

ReennaammeeSSmmaarrtt

- to rename label of a smart key

•

Select an existing smart

•

Tap a character from the touch screen

•

Tap

DEELLEETETE

to last entered character

•

Tap BBAACKCKto ignore and return to previous page

•

Tap OKOKto confirm

Note: When a SSmmaartrtis executed, press a hard key (e.g. ,

CCHH++,,CCHH,,VVooll++,,VVool-

) to stop the signal transmission. User can set maximum 32 steps (including delay) for each smart program. The maximum delay time is 20 seconds.

Remote Control

CClloonne

This function is used to copy user setting to another Halcro Logic UTSR1. Tap M

MEENUNU

,thentapClCloone

and choose any one of the following items:

Note: Before you perform this function, please make sure that you have two (2) Halcro Logic UTSR1s. You have to identify which unit is the sender and which one is the receiver. The sender is the unit which contains data that will be transferred to another Halcro Logic UTSR1 (receiver unit). The receiver is the unit which will copy the signals from the sender. Please keep both sender and receiver units face to face at a distance of 5 to 8cm during the whole cloning process.

CCopopyyOOnneeDeDevviiccee– copy all user settings of a single device from the sender to the receiver unit

•

On the receiver unit, tap RReecceeiive

•

On the sender unit, tap CCopopyyOOnneeDeDevviicece,thentap to select a device (e.g. TV), all user settings in the selected device will be sent out via the IR linking from the sender to the receiver unit

CopopyyAAllllDeDevviicceess

– copy all user settings of all devices

from the sender to the receiver unit

•

On the receiver unit, tap RReecceeiive

•

On the sender unit, tap CCopopyyAAllllDeDevviicceses,alluser settings will be sent out via the IR linking from the sender to the receiver unit, except Cl

Cloockck

and

Paasssswwoordrd

will be sent out via IR linking

Reecceeiivvee––

receive data for Clone function (receiver unit has to select this function in order to start cloning) Enter into receiving mode, ready for receiving incoming data.

5-8 cm

Note: All user settings will be over-written at receiving end by sending remote. Do NOT interrupt the linking during sending and receiving data. Be sure to keep two remotes within 5 to 8cm during the copy process for better performance.

PPCCLLiinnk

To connect your Halcro Logic UTSR1 with a computer to download/upload data, Tap M

MEENUNU

, then

choose P

PCCLLinink.k.

Note: To enable PC-to-remote data upload/download function, you must use the Halcro Docking Station.

IInntteerac

racttiivveeHHeellppSScrcreeeenn

In menu mode, there is a Help icon on the top right corner of screen. It provides help information for each sub-level of the menu.

IIMMPPOORRTTAANNTTNNOOTTE:E:Do not drop or apply any shock to the unit. If the unit does not work properly, press R

Reessetet

key once to restart. (Reset key is located inside

the battery compartment).

If password is set, user needs to enter password for accessing main menu. Enter AAAAA

AAAAA

if you forget the

password.

Docking Station

BBeeffoorreeopopeerraattininggtthheeHaHallccrrooLLogogiiccDDoocckkininggStStaattiioonn,

pplleeaasseerreeaaddtthihissmmaanunuaall.

KKeeyyFFeeatur

atureess

•

Fast charging device for your Halcro Logic UTSR1

•

Connecting your Halcro Logic UTSR1 to home computer system for remote advanced editing and data back up (PC Link)

•

LED indicator for charging status display

•

USB Cable included for PC connection

Spe

Specciiffii

cat

catiioonnss

•

Power Requirement: DC 9V, 400mA, 3.6VA

•

Charging Time: 3-4 hours

•

Dimensions: 225 x 100 x 45mm

•

Weight: 130g approx.

•

ncluded Accessory: USB CableI

1. Docking Station 5. LED Indicator

2. Remote Holder 6. ower Connector

3. Connection Pins 7. USB Jack

4. Release Button

Docking Station

QQuuiicckkCChar

hargegerr

Funct

Functiioonn

•

Make sure that your Halcro Logic UTSR1 is installed with 4xAAA NiMH rechargeable batteries and remove the rubber protector

•

Make sure you have the DC power adaptor from the Halcro Logic UTSR1 package

•

Put the power adaptor into AC wall outlet, insert the DC jack to the power connector of the Docking Station

•

Now, slide your Halcro Logic UTSR1 onto the Docking Station until the connection pins are locked

•

The Green LED of the Docking Station lights up. It takes approximately 3 to 4 hours to fully charge the remote

•

When the charging process is completed, the Green LED of the Docking Station will be turned off

•

Press the RReelleeaasseebutton of the Docking Station to release the Halcro Logic UTSR1

RReemmootteeAAddvvanc

ancededEEddiittiinnggvviiaaCCoommppuutterer

•

Make sure that your computer is loaded with one of the following operating systems: Windows 98SE, Windows 2000, Windows NT or Windows XP

•

Download the Halcro Editor software from www. halcro.com. Install the program and reboot

your

system

•

Make sure your Halcro Logic UTSR1 is connected with the Docking Station (See Quick Charge Function, point 4)

•

Connect the supplied USB cable to the USB jack of the Docking Station and one of the available USB connectors of your computer system

•

ctivate the PPCCLLink

ink

function on the Halcro Logic

UTSR1 by tapping M

Meenunu

and then, select PPCCLLink

ink

•

Run the Halcro Editor software from your computer system

Note: For operating the

Halcro Editor

software, please follow the instruction manual from the software package.

MMaaiinntteenanc

nancee

•

Do not expose your Docking Station to dust, strong sunlight, humidity, high temperature, or mechanical shock

•

Do not use corrosive or abrasive cleansers on your Docking Station

•

Keep the unit dust free by wiping it with a soft, dry cloth

•

Do not disassemble your Docking Station

Troubleshooting

UUTTSSRR1

MMyyHaHallccrrooLLogogiiccUUTTSSRR11iis

nnototwwoorrkkiningg.

Make sure the provided rechargeable batteries are inserted with correct polarity and are fully charged. Try pressing the R

Reessetet

button inside the battery compartment. (Refer to page 9 for details)

Ihhaavveeininssttaalllleeddaaccododee

bbuutttthheerreemmototeeiissnnot

wwoorrkkininggoorroonlnlyyppaarrttlly

wwoorrkksswwiitthhmmyyddeevviicce.

Try another code available on the code list or go through the A

Auutoto

SSeeaarrcchhto locate another possible code. OR use the L

Leeaarr

ning

function. (Refer to page 10 for details)

Ihhaavveeccopopiieeddmmyyooririggininaall

rreemmototeetotoHaHallccrrooLLogogiic

UUTTSSRR11bbuuttffooununddtthhaat

ssoommeeccoommmmaannddssoonlnly

wwoorrkkoocca

ccassiioonnaallllyy..

Your original remote may carry dual signal commands. (Refer to page 11 for details)

Icacannnnototmmoovveeaakkeeyytoto

aannotothheerrlloocacattiioonn.

Make sure the selected key type is identical. You cannot exchange key position with different key type. (Refer to page 14 for details)

HoowwcacannIIrreesstotorreemmyy

ffacactotoryrysseettttiningg?

(Refer to page 16 for details)

HoowwcacannIIpprreevveenntt

ssoommeeoonneeffrroommeeddiittininggoor

cchhaannggininggtthheesseettttininggss?

Activate the PPaasssswwoord

function to lock your remote. (Refer to page 16 for details)

Ihhaavveeffoorr

gott

gotteennmmyy

ppaasssswwoorrdd.

The factory preloaded password is AAAAA

AAAAA

ThTheebbacackkliligghhttoofftthheeLLCCD

iissnnototwwoorrkkiningg.

Make sure you have selected either By

SSeennssororor AAllwwaaysysOnOnin the Remote Setting menu. (Refer to page 15 for details)

WhhaattiissCCLLOONNEE??

To perform this function, you must have 2 Halcro Logic UTSR1s. (Refer to page 20 for details)

WWhhaattiissSSMMAARRTT?

Using the programmed SMART button will execute a series of commands. (Refer to page 18 for details)

WhhaattiissPPCCLLininkk??

In order to perform this function, you must have a Halcro Logic Docking Station and the corresponding computer software. (Refer to page 21 for details)

DDoocckkiinnggSStat

tatiioonn

MMyyHaHallccrrooLLogogiiccDDoocckkining

StStaattiioonndodoeessnnototcchhaarrgge

mmyyrreemmotote.

Make sure that your Docking Station is connected properly with the Halcro Logic UTSR1. Check whether your Halcro Logic UTSR1 is loaded with packaged NiMH rechargeable batteries and are inserted with correct polarity. Make sure that you have connected the DC power supply with your Docking Station and an available AC outlet.

HoowwcacannIIccoonnnneeccttmmyy

HaHallccrrooLLogogiiccUUTTSSRR11wwiitth

mmyyccoommppuutteerrsys

systteemm??

Please refer to page 24 Remote Advanced Editing via Computer. Make sure you have activated the PC Link function from the Halcro Logic UTSR1.

Note: The Halcro Logic UTSR1 and Docking Station contain no user serviceable parts. For all service requirements please contact your dealer.

Device Code List

PPrreeaammp

Model Code

Halcro dm8/dm10 0002

SSurr

urrooununddSoSoununddPPrroocceessssoorr

Model Code

Halcro SSP100/SSP80 0007

TTV

Model Code

A.R. Systems 1021 Accent 1021 Admiral 1001 Agef 1001 Aiko 1021 Aim 1021 Akai 0331 0841 1021 Akiba 1021 Akito 1021 Akura 1021 Alba 0431 1021 1041 Allstar 1021 Amplivision 1041 Amstrad 0481 1021 Anam 0251 1021 Anam National 1021 Anitech 1021 Ansonic 1021 1031 1041 AOC 0361 Aristona 1021 ASA 1001 Asberg 1021 Atlantic 1021 Audiosonic 0711 1021 1041 Audioton 1041 Autovox 1001 AWA 1021 Bang & Olufsen 0991 1001 1051 Basic Line 1021 Bauer 0441 Baur 0661 1011 1021 Beko 1021 1041 Beon 1021 Best 1041 Bestar 1021 1041 Blaupunkt 0911 0921 Blue Sky 1021 BPL 1021 Brinkmann 1021 Brionvega 1001 1021 Bruns 1001 BSR 0841 Bush 0751 1021 Candle 0351 0361 Carad 1021 Carena 1021 Cascade 1021 Casio 1021

Cathay 1021 CCE 1021 Centurion 0411 1021 Century 1001 CGE 0841 1041 Citizen 0351 0361 Clatronic 0711 1021 1041 Colortyme 0361 Concerto 0351 Condor 1021 1041 Craig 0251 Crosley 0841 1001 Crown 1021 1041 Curtis Mathes 0161 0361 Daewoo 0291 0301 0331 1021 Dansai 1021 Dantax 1041 Dawa 1021 Daytron 1021 Decca 0271 0671 1021 Deitron 1021 Desmet 1021 Diamant 1021 Digiline 1021 Dixi 0331 1021 Drean 1021 Dual 0891 1021 Dual-TEC 0901 Dumont 0841 1001 Dux 1021 Dynatron 1021 Elbe 1021 1031 1041 Elcit 1001 ELG 1021 Elin 1021 Elite 1021 Elta 0331 Emerson 0021 0061 0071 0081 0091

0101 0111 1001 Envisio 0361 Erres 1021 ESC 1021 Etron 0331 0841 1021 Euroman 1021 1041 Europa 1021 Europhon 0671 1021 Exquisit 1021 Family Life 1021 Ferguson 0711 Fidelity 0821 1021 Finlux 0841 1001 1021 First Line 0841 1021 Fisher 0171 0841 1001 1041 Flint 1021 Formenti 0441 0841 1001 Fortress 1001 Fraba 1021 1041 Friac 1021 Frontech 0711 0841 Funai 0711 Galaxi 1021 Galaxis 1021 1041

1021

Device Code List

GBC 0841 GE 0131 0161 0201 GEC 0271 0671 1021 Geloso 0841 Gemini 0391 Genexxa 0431 1021 Goldstar 0031 0121 0351 0411 1021

1041 Goodmans 1021 Goodmans/Tashiko 0011 0271 Gorenje 1041 Gradiente 1021 Graetz 1021 Granada 0671 0841 1021 Grandin 1021 Grundig 0671 0871 0951 0961 1021 Hanseatic 1001 1021 1031 1041 Hantarex 0671 1021 Hantor 1021 Harwood 1021 Hauppauge 1021 HCM 1021 Highline 1021 Hinari 0841 0861 1021 Hit 1001 Hitachi 0181 0351 0841 1021 Hornyphone 1021 Hypson 1021 Iberia 1021 ICE 1 021 Imperial 1021 1041 Indiana 1021 Inno Hit 0671 0851 0861 1021 Innovation 0951 0961 Interfunk 0841 1001 1011 1021 1041 Internal 1021 Intervision 1021 1041 Irradio 0851 0861 1021 Isukai 1021 ITS 1021 ITT 0751 0841 0931 ITT Nokia 0751 0841 0931 ITV 1021 Jensen 0311 JVC 0001 0261 0281 0751 Kaisui 1021 Karcher 1021 1041 Kendo 1021 1041 Kennedy 0841 Kenwood 0361 Kneissel 1021 1031 1041 Kolster 1021 Konka 1021 Korpel 1021 Korting 1001 1041 Kosmos 1021 Lecson 1021 Lenco 1021 Leyco 1021 Leyeo 0711 LG 1021 1041 Liesenkotter 1021

Lifesat 0951 Lifetec 0951 1011 1021 Loewe 1001 1011 1021 1031 1041 Loewe Opta 0661 0671 0681 Logik 0381 Luma 1021 Lumatron 1021 Lux May 1021 Luxman 0351 Luxor 0841 Lyc o 0711 Madison 1021 Magnadyne 0671 0841 1001 Magnafon 0671 Magnasonic 0031 Magnavox 0341 0391 0401 0411 0421

0581 Manesth 1021 Manhattan 1021 Marantz 0221 0351 0361 1021 Marelli 1001 Mark 1021 Matsui 0271 0331 1021 Maximal 0841 Mediator 1021 Medion 0951 0961 1021 Melectronic 1011 1021 Memorex 0331 0351 0381 0571 Mercury 1021 Metz 0881 1001 MGA 0361 0561 0571 Micromaxx 0951 1021 Minoka 1021 Mitsubishi 0221 0321 0561 0571 0751

1001 1011 1021 Mivar 0671 1031 1041 Montgomery 0351 Morgan's 1021 MTC 0351 0361 1011 1041 Multitec 1021 Multitech 0671 1021 1041 NAD 0551 Naiko 1021 Nakimura 1021 NEC 0241 0351 0361 1021 Neckermann 0821 0841 1001 1021 1041 NEI 1021 Netsat 1021 Neufunk 1021 New Tech 1021 Nikkai 0271 0431 0861 1021 Nikko 0031 Noblex 1021 Nokia 0751 0841 0931 0941 0971 Nordmende 1021 Novatronic 1021 Oceanic 0841 Okano 1021 1041 Opera 1021 Optimus 0551 Optonica 0541 Orbit 1021

0601 1021

Device Code List

Orion 0841 1021 Orline 1021 Osaka 0861 Osaki 0271 0861 1021 Osio 1021 Otto Versand 0751 0841 1011 1021 Palladium 1001 1021 1041 Palsonic 1021 Panama 1021 Panasonic 0191 0251 1021 Panavision 1021 Pathe Cinema 1031 Penny 0161 0351 0361 0521 0531 Perdio 1021 Perfekt 1021 Philco 0361 0581 0591 0601 1001

1021 1041

Philips 0401 0651 0691 0701 0721

1001 1021 Phoenix 1001 1021 1041 Phonola 1001 1021 Pilot 1021 Pioneer 0511 0551 1021 1041 Pionier 1041 Plantron 1021 Prandoni-Prince 0671 Prandoni-Promce 0671 Profex 0841 Profitronic 1021 Proline 1021 Prosonic 1021 1041 Protech 0711 0841 1021 Proton 0351 0501 Provision 1021 Pulser 0351 Pye 1001 1021 Quasar 0251 Quelle 0641 1011 1021 R-Line 1021 Radialva 1021 Radiola 1021 Radiomarelli 1001 1021 RadioShack 0541 1021 Radiotone 1021 1041 RCA 0051 0141 0151 0181 0411

0491 0531 Realistic 0541 Recor 1021 Rectiligne 1021 Rediffusion 0841 0931 Redstar 1021 Reflex 1021 Revox 1021 1041 Rex 0891 0901 RFT 1 001 1031 1041 Roadstar 1021 Robotron 1001 Rodex 1021 Royal Lux 1041 Saba 0671 1001 Saisho 0331 Salora 0821 0841

Sambers 0671 Sampo 0361 Samsung 0331 0341 0351 0361 0711

0861 1021 1041 Sansui 1021 Sanyo 0171 0231 0271 0751 1021

1031 1041 Save 1021 SBR 1021 Schneider 0891 0901 1021 Sears 0161 0171 0351 0481 0521 SEG 1021 SEI 0841 1001 1021 Seleco 0891 0901 Sharp 0461 0471 0541 0611 0621 Siam 1021 Siarem 0671 0841 1001 Siemens 0861 0911 0921 1021 Siera 1021 Siesta 1041 Signature 0351 0381 Silva 1021 Silver 0711 1021 Simpson 0581 Singer 1001 1021 Sinudyne 0841 1001 1021 Sky 1021 Solavox 0861 Sonitron 1041 Sonneclair 1021 Sonoko 0711 1021 Sontec 1021 1041 Sony 0371 0451 0631 Soundwave 1021 Squareview 0481 Standard 1021 Starlite 1021 Stern 0891 0901 Strato 1021 Sunkai 1021 Sunstar 1021 Sunwood 1021 SuperTech 1021 Supra 0351 Sylvania 0361 0441 0581 0591 0601 Symphonic 0481 Tandberg 0681 0761 0881 Tandy 0271 0431 Tatung 0271 0671 1021 Tcm 0951 Teac 1011 1021 Tech Line 1021 Techwood 0351 Teknika 0351 0381 0571 Telecor 1021 Telefunken 0691 0731 0741 0771 0781

0791 0811 0981 Telefusion 1021 Telegazi 1021 Telemeister 1021 Telesonic 1021 Telestar 1021

1021

Device Code List

Teletech 0331 1021 Tempest 1021 Tennessee 1021 Tensai 1021 Tera 0501 Tevion 1021 Thomson 0691 0731 0741 0771 0781

0791 1021 Thorn 1011 1021 Thorn-Ferguson 0711 TMK 0351 Tokai 1021 Toshiba 0351 0521 0751 0801 Trans Continens 1021 Transonic 1011 1021 Triumph 0671 1021 Uher 1021 1041 Ultravox 0841 1001 1021 Unic Line 1021 United 1021 Universum 0711 1011 1021 1041 Univox 1001 1021 Vector Research 0361 Vestel 1021 Vexa 1021 VideoSystem 1021 Vidikron 0211 Vision 1021 Vortec 1021 Voxson 1001 1021 Waltham 1021 Wards 0361 0381 0451 0541 0581

0591 0601 Watson 1021 Watt Radio 0841 Wega 0841 1001 1021 Weltblick 1021 Wharfedale 1021 White Westinghouse 1021 Xrypton 1021 Yamaha 0361 Yamishi 1021 Yokan 1021 Yoko 1021 1041 Zanussi 0891 0901 Zenith 0011 0041 0381

SSAATT//CCBBL

Model Code

ABC 0253 0373 Akiba 0963 Alba 0963 Allsat 0923 Alpha Star 0773 Amstrad 1143 Ansonic 0953 Antronix 0133 Archer 0133 0283 Astra 1053 Autovox 1113 BB 0073

Beko 0963 British Sky Broadc asting (BskyB) 1143 BT 1033 Cabletime 0163 Canal Digital 0943 Canal Satellite 0943 0953 Canal + 0863 Canalt 0943 Carena 0963 Clyde Cablevision 0193 Colour Voice 0303 0343 Comtronics 0213 0273 Conrad 1063 Cyrus 0923 D-Box 1073 1213 1253 DNT 0923 Dual 1113 Eagle Comtronics 0273 Eastern 0063 Echostar 0783 0943 Electricord 0203 Electus 0263 Ferguson 1113 Finlandia 0963 1053 Finlux 0963 Flint 0963 GE 0113 0123 GEC Cable System 0193 General Instrument 0793 0803 Gold Box 0943 0953 Gooding 1023 Goodmans 0403 0963 Granada 1053 Grundig 0973 0983 1023 1143 Hamlin 0633 0643 0653 0663 0673 Hirschmann 1063 Hisawa 0963 Hitachi 0753 0963 HTS 0783 Hughes Network Systems 0813 ITT 1053 ITT Nokia 1163 Jerrold 0253 0433 0593 0603 0613

0803 0823 JOK 1033 JVC 1023 Kathrein 0923 Luxor 1053 1063 1073 Magnavox 0003 0413 0423 0763 Mamm 0293 Manhattan 0963 Marantz 0923 Maspro 0973 1113 Matsui 1023 MediaSat 0943 Memorex 0003 0383 0763 Minerva 1023 Mitsubishi 1053 Mivar 0953 Movie Time 0143 0203 Myryad 0923

Device Code List

Nokia 0963 1053 1063 1073 1083

1203 1223 1233 1243 1263

1273 Northcoast 0013 NSC 0143 OAK 0103 OAK Sigma 0533 0543 Ondigital 0933 1013 1093 Pace 0903 0963 1093 1103 1113

1123 1133 1143 1153 1223 Palladium 1023 Panasat 1173 Panasonic 0443 0453 0463 0473 1143 Panda 0963 Paragon 0383 Philips 0003 0033 0213 0303 0313

0323 0333 0343 0413 0423

0763 (Philips) 0913 0923 0933 0943 0953

0963 0973 0983 0993 1003

1013 (Philips) 1023 1033 1043 1223 Pioneer 0003 0083 0553 0693 0943 Premiere 0943 0953 1073 Primestar 0803 0823 Pulsar 0383 Promax 0963 Radiola 0923 RCA 0833 RCA Digital Satellite System 0393 0403 Realistic 0133 Regency/Eastern 0683 RFT 0923 Runco 0383 Saba 1033 1113 Sabre 0963 Sagem 0963 1183 Salora 1053 Samsung 0273 Schneider 0983 1113 Scientific Atlanta 0363 0563 0573 0583 Sedea 0863 0873 0883 Signal 0273 Sky 0893 SL Marx 0273 Sony 0843 1143 Spectavision 0233 Standard Components 0183 Starcom V 0253 Stargate 0273 Strong 1173 Sylvania/Tex scan 0373 0493 Tandberg 1193 Tantec 0963 1113 Teknika 0173 Teleservice 0053 Teleview 0273 Texscan 0183 0373 TFC 0023 Thomson 0943 0963 Tocom 0223 0353 0503 0513 0523 Toshiba 0383 0853

Tps 0873 1183 Tudi 0043 Universum 1023 Uniden 0763 Unika 0133 Universal 0133 0153 0203 0283 Ventana 0923 Videoway 0093 Viewstar 0213 Wisi 0963 Xsat 0883 Zenith 0243 0383 0483

CCD

Model Code

Acoustic Research 1346 ADC 0076 0116 Adcom 0256 0306 1066 ADS 0316 Aiwa 0346 0996 1086 1106 Akai 0226 0536 0586 Alpine 1266 1356 Audio-Technica 0596 BSR 0296 0706 0826 California Audio Lab 0106 Cambridge Audio 1416 Capetronic 1256 Carrera 0296 Carver 0336 1186 Casio 0396 Crown 0236 Curtis Mathes 0396 Denon 0326 0926 0936 Dual 0556 Dynamic Bass (h) 0606 Emerson 0256 0376 1156 Eroica 1326 Fisher 0146 0606 0976 1056 Garrard 0416 Genexxa 0356 0376 1156 Goldstar 1186 1276 1316 1386 H/K 0156 0226 0516 1046 Hitachi 0246 0256 0556 0866 Inkel 0166 0446 JVC 0366 Kenwood 0096 0146 0456 0636 0776

0786 0796 0806 0946 Kyocera 0076 Luxman 0126 0476 0726 0756 0766

1036 Magnavox 0216 0266 0696 1006 Marantz 0266 0286 0426 0836 1396

Mcintosh 0406 1136 MCS 0956 1366 Memorex 0256 0276 0286 0356 0376

1156 MGA 0186 Mission 0266 Mitsubishi 0186 0496

Device Code List

MTC 1306 NAD 0086 0666 0736 0746 Nakamichi 0176 0486 0566 NEC 0306 0956 1016 Nikko 0596 1056 Onkyo 0206 0506 0546 0856 1206 Optimus 0276 0296 0606 0646 0896

0906 0916 0946 0986 Panasonic 0106 0876 1146 1176 Penny 0956 Philips 0216 0266 Pioneer 0356 0986 1096 Proton 0266 1236 Quasar 0106 RCA 0256 0966 1166 Realistic 0256 0276 0286 0376 0606

0896 Revox 1226 Rotel 0006 0016 0026 0036 0046

0266 Saba Telecommander (e) 0556 SAE 0266 Samsung 1336 Sansui 0226 0676 1026 1076 1156 Sanyo 0196 0606 0686 0816 Scott 0376 1156 Sears 0396 Sharp 0286 0716 0946 1116 1126 Sherwood 0166 0286 0446 0526 Siements Garrard 1296

DDVVD

Model Code

Akai 0068 Denon 0208 Finlux 0278 Goldstar 0278 Grundig 0288 Hanseatic 0278 Harman/Kardon 0318

Signature 0226 Sontec 1216 Sony 0116 0616 0916 1196 Staron 1286 STS 0076 Sylvania 0266 Symphonic 0386 Tandy 0356 Tangberg 1246 Teac 0286 0386 0436 0576 0846

0886 1406 Technics 0106 0656 1146 Techwood 1376 Telefunken 0556 Thomson 0556 Toshiba 0086 0736 Vector Research 0116 1186 Victor 0366 Wards 0226 Yamaha 0056 0066 0136 0466 0596

0626 1116

Hitachi 0308 0338 0378 JVC 0098 0188 0288 Kenwood 0158 LG 0278 Linn 0358 Loewe 0288 0368 Marantz 0218 0288 Magnavox 0138 Micromedia 0288 Micromega 0288 Mitsubishi 0148 NAD 0328 Onkyo 0078 0138 Optimus 0228 Panasonic 0038 Philips 0108 0138 0218 0288 0368 Pioneer 0118 0128 0198 0228 Proscan 0168 RCA 0168 Rotel 0008 Salora 0278 Samsung 0088 0338 Sharp 0048 Sherwood 0238 Shinco 0258 Sony 0028 0268 0348 0388 Sony-PS2 0298 Teac 0278 Technics 0038 Theta Digital 0228 Thomson 0178 Toshiba 0058 0138 Universum 0278 Xbox 0398 Yamaha 0018 0138 0148 0158 0168

Zenith 0138 0248 0278 3Dlab 0288

0178 0288

Service & Warranty

SeSerrvviicceeIInnffoorrmmatatiioon

The Halcro Logic Universal Touch Screen Remote (UTSR1) and Docking Station have been designed for maximum reliability. If a problem does occur with your unit, please contact your dealer. Do not open the cover, or try to modify or repair the products yourself.

Contact your dealer to help you with some trouble shooting prior to organizing service for your UTSR1 and Docking Station. Your dealer or HALCRO’s service department will always try to help you correct any basic problems at your home via email or telephone.

If service is required, all problems must be described in as much detail as possible. This will help streamline the service process.

Return Authorization from HALCRO prior to shipment must be obtained for any service requirements. To obtain this authorization, please ask your dealer or email us at service@halcro.com

HALCRO will not be responsible for any damage caused to your products during shipping due to improper packaging.

WWarrant

arrantyyIInnffoorrmmatatiioonn

IMPORTANT - Please read the following details very carefully.

The Halcro Logic Universal Touch Screen Remote (UTSR1) and Docking Station are warranted to be free of defects if used under normal conditions for a period of ninety (90) days from the date of purchase. To extend the warranty period to twelve (12) months, please complete and return the warranty registration form.

Do not attempt to open the product. Breaking the seals will void the warranty and all service, repair and freight costs will be charged to the owner. Willful damage, tampering, and damage caused by moisture are not covered by the warranty.

The warranty will only be recognized by HALCRO if a copy of the original receipt from your dealer showing all details including the date of purchase, accompanies the completed warranty registration form. The warranty period will commence at the date of purchase, not at the date the warranty registration form is received by HALCRO.

Return Authorization from HALCRO prior to shipment must be obtained for any warranty requirements. To obtain this authorization, please email HALCRO at service@halcro.com

The warranty registration form is included in this owner's manual on the following page. Please cut it out carefully and return it to HALCRO. You will find HALCRO’s address and facsimile details on the warranty registration form.

Service & Warranty

WWarrant

arrantyyRRegegiissttrarattiioonnFFoorrmm

Title………..First Name...........................................

Surname.................................................................

Date of Birth:

Day………..Month.........................Year…………...

Address: .................................................................

.................................................................................

Zip/Postcode:……………… Country: ...................

Phone Numbers:

Home ( )............................................................

Work ( ) ...........................................................

Facsimile Numbers:

Home ( )............................................................

Work ( ) ...........................................................

Email Address:.......................................................

Model Number .....................................................

Serial Number........................................................

Date of Purchase:

Day………..Month...................... Year……………..

Purchased From (Dealer Name): ........................

.................................................................................

Please complete all sections of the form and attach a copy of the original receipt for the warranty to be accepted. Please refer to the previous page for details of the warranty period for your model.

Post to: HALCRO, 118 Hayward Ave,

Torrensville, South Australia 5031

Fax to: +61 8 8238 0852

Halcro UTSR1 Owner's Manual

Specifications and Main Features

Frequently Asked Questions

User Manual