Gaggenau DF480763, GARECTWODW253, GARECTWODW252 Operating manual
*DJJHQDX
en-us Operating instructions
fr-ca Notice d'utilisation
Dishwasher
DF480/DF481
2
Table of contents
en-us Operating instructions
(
Safety Definitions 6
(
IMPORTANT SAFETY INSTRUCTIONS 7
Risk of fire, electrical shock, or serious injury 7
GROUNDING INSTRUCTIONS 8
Safe Operation 8
Child Safety 9
Proper Care and Maintenance 9
ƒ
Causes of Damage 10
*
Getting Started 11
Appliance overview 11
Operating panel 12
Dishwasher interior components 12
Display indicators 12
Info button 12
Time setting 12
Switching on the appliance for the first time 13
Settings 13
Home Connect™ System 15
Setting up the app 15
Setting up Home Connect 15
WLAN | 15
Network login 15
Connect to App 15
Remote start button 16
Wi-Fi without a connection to the
Home Connect server 16
Remote diagnosis 16
+
Water softening system / special salt 16
Water hardness table 16
Adjusting the water softening system 17
Using special salt 17
Detergent with a salt component 17
Switching off water softening system 17
en-us
,
Rinse Aid 18
Adding rinse aid 18
Setting the amount of rinse aid used 18
Switching off rinse aid refill indicator 19
-
Loading the Dishwasher 19
Dishware material 19
Glass and silverware damage 20
Loading the racks 20
Recommended loading pattern 21
Loading the silverware basket 22
Rack accessories 23
Unloading the dishwasher 25
Adjusting the height of the rack 25
Upper rack with side levers 26
Removing/Installing third rack 26
Removing/Installing upper rack* 27
Removing/Installing lower rack 28
.
Detergent 29
Adding detergent 29
Combination detergent 30
/
Dishwasher Cycles 31
0
Dishwasher Cycle Options 32
Intensive Zone 32
Power 32
Half Load 32
Hygiene 32
Zeo Dry (Extra Dry with Zeolite) 32
Wash Cycle Information 32
3
en-us
1
Operating the Dishwasher 34
Protection against unintentional operation 34
Operating the touch buttons 34
Changing the settings 34
AquaSensor 34
Zeolite Drying 35
Time display 35
Opening the door 35
Sensor setting 35
Extra Dry 35
Eco forecast 35
Auto power off 35
Tone volume 36
Button volume 36
Child-proof lock 36
Greeting 36
Factory setting 36
Switching the appliance on 36
Delay start time 36
InfoLight
® *
36
Remaining time projection 37
EmotionLight 37
Wash cycle end 37
Switching off the appliance 37
Interrupting the wash cycle 37
Cancel a cycle (reset) 37
Changing the wash cycle 37
2
Care and Maintenance 38
Cleaning the dishwasher 38
Special salt and rinse aid 38
Filters 39
Spray arms 40
Drain pump 41
Preparing your unit for vacation 41
Winterizing your unit 41
3
Troubleshooting 42
Error message 42
Fault table 42
4
Customer Service 49
‡
Statement of Limited Product Warranty 49
What this Warranty Covers & Who it Applies to: 49
How Long the Warranty Lasts 49
Repair/Replace as Your Exclusive Remedy 50
Out of Warranty Product 50
Warranty Exclusions 50
How to Obtain Warranty Service 51
5
Installation and connection 52
Parts included 52
Safety instructions 52
Delivery 52
Technical specifications 52
Installation 53
Drain connection 53
Water supply connection 53
Hot water connection 54
Electrical connection 54
Removing the appliance 54
Transporting the appliance 55
Securing the appliance against frost 55
4
en-us
&RQJUDWXODWLRQVDQG7KDQN<RXIURP*DJJHQDX
7KDQN\RXIRUVHOHFWLQJD*DJJHQDXGLVKZDVKHU<RXKDYHMRLQHGWKHPDQ\FRQVXPHUV
ZKRGHPDQGTXLHWDQGVXSHULRUSHUIRUPDQFHIURPWKHLUGLVKZDVKHUV
7KLVPDQXDOZDVZULWWHQZLWK\RXUVDIHW\DQGFRQYHQLHQFHLQPLQGDQGWKHLQIRUPDWLRQFRQWDLQHGKHUHLQLVYHU\LPSRUWDQW
:HKLJKO\UHFRPPHQGWKDW\RXUHDGWKLVPDQXDOEHIRUH\RXXVH\RXUGLVKZDVKHUIRUWKHILUVWWLPH
7ROHDUQHYHQPRUHDERXW\RXUGLVKZDVKHUDQGDYDLODEOHDFFHVVRULHVDVZHOODVPDQ\RWKHUWRSTXDOLW\
*DJJHQDXDSSOLDQFHVYLVLWRXUZHEVLWHDWZZZJDJJHQDXXVDFRP
3OHDVHFRQWDFWXVLI\RXKDYHDQ\TXHVWLRQVRUFRPPHQWV
*DJJHQDX
0DLQ6WUHHW6XLWH
,UYLQH&$
86$
3KRQH
LQIR#JDJJHQDXXVDFRP
ZZZJDJJHQDXXVDFRP
5
en-us Safety Definitions
(
Safety Definitions
Safety Definitions
9 WARNING
This indicates that death or serious injuries may
occur as a result of non-observance of this
warning.
9 CAUTION!
This indicates that minor or moderate injuries may
occur as a result of non-observance of this
warning.
NOTICE: This indicates that damage to the appliance or property may occur as a result of non-compliance with this advisory.
Note: This alerts you to important information and/or tips.
6
9 IMPORTANT SAFETY INSTRUCTIONS
READ AND SAVE THESE INSTRUCTIONS
(
IMPORTANT SAFETY INSTRUCTIONS
This dishwasher is provided with Installation
Instructions and this Use and Care Manual.
Read and understand all instructions before
using the dishwasher.
This dishwasher is intended for use up to a
maximum altitude of 8,200 ft (2,500 meters)
above sea level.
To reduce the risk of fire, electrical shock, or serious injury, observe the following:
Risk of fire, el ect ri c al shock, or seri ous injury
9 WARNING
9 WARNING
Risk of electrical shock or fire!
Electrical shock or fire could result if the
electrical supply for the dishwasher
covered in this manual is incorrectly
installed or if the dishwasher has been
improperly grounded. Do not use the
dishwasher covered in this manual unless
you are certain the electrical supply has
been correctly installed and the
dishwasher has been properly grounded.
Risk of injury or death!
Misuse of the dishwasher can result in
serious injury or death. Do not use the
dishwasher in any way not covered in this
manual or for any purpose other than
those explained in the following pages.
9 WARNING
Risk of injury!
Severe injury and/or product damage
could result from the use of unauthorized
service technicians or non-original
replacement parts. All repairs must be
performed by an authorized service
technician using only original equipment
factory replacement parts.
9 WARNING
RIsk of explosion!
▯ Under certain conditions, hydrogen
gas may be produced in a hot water
system that has not been used for two
weeks or more. Hydrogen gas is
explosive. Before using a dishwasher
that is connected to a hot water system
that has been unused for two weeks or
longer, turn on all hot water faucets
and let the water flow from each for
several minutes. This will release any
accumulated hydrogen gas. As the gas
is explosive, do not smoke or use an
open flame during this time.
▯ When cleaning your dishwasher with
any cleaning agent, remove all
cookware, utensils or any foreign
material from inside. Some cleaning
agents are highly acidic and/or caustic
alkaline, which can cause hydrogen
gas to form if aluminum material is also
inside the dishwasher tub. Hydrogen
gas is explosive. Refer to the Care and
Maintenance section of the dishwasher
Use and Care manual for instructions on
how to properly clean your dishwasher.
7
9 IMPORTANT SAFETY INSTRUCTIONS
READ AND SAVE THESE INSTRUCTIONS
9 WARNING
Health hazard!
Never use harsh chemicals to clean your
dishwasher. Some bleach-based products
can damage your dishwasher and may
present health hazards!
GROUNDING INSTRUCTIONS
This appliance must be grounded to a metal,
permanent wiring system or an equipment
grounding conductor must be run with the
circuit conductors and connected to the
equipment grounding terminal or lead on the
dishwasher. See the Installation Instructions
included with this dishwasher for more
information on electrical requirements.
9 WARNING
Risk of electric shock!
This appliance must be grounded. In the
event of a malfunction or breakdown,
grounding will reduce the risk of electric
shock by providing a path of least
resistance for electric current. This
appliance is equipped with a cord having
an equipment-grounding conductor.
Improper connection of the equipmentgrounding conductor can result in risk of
electric shock. Check with a qualified
electrician if you are in doubt whether the
appliance is properly grounded.
Safe Operation
Use this dishwasher only for its intended
function, which is the washing of household
dishware and kitchenware rated as dishwasher
safe.
Use only detergents or rinsing agents
recommended for use in a dishwasher, and
keep them out of the reach of children.
9 CAUTION!
When loading items to be washed:
■ Locate sharp items so they are not
likely to damage the door seal.
■ Load knives and other sharp utensils
with their HANDLES UP to reduce the
risk of cut-type injuries.
■ Do not wash plastic items unless they
are marked “dishwasher safe” or the
equivalent. For plastic items not so
marked, check the manufacturer’s
recommendations.
■ Do not operate your dishwasher unless
all enclosure panels are in place.
■ Do not tamper with or override
controls and interlocks.
Do not abuse, sit or stand on the door or dish
racks of the dishwasher.
9 WARNING
Risk of injury!
To avoid risk of injury, always use caution
when opening the door during or
following a wash cycle as hot water or
steam may escape. Do not fully open the
door until water noises have stopped and
steam has subsided.
8
9 IMPORTANT SAFETY INSTRUCTIONS
READ AND SAVE THESE INSTRUCTIONS
NSF/ANSI 184 Certified residential
dishwashers are not intended for licensed
food establishments.
Ensure that you follow the safety instructions,
even when they are out of reach while
operating the appliance via the Home Connect
app. Also follow the instructions provided by
the app.
Child Safety
To reduce risk of injury, do not allow children
to play in or on the dishwasher.
When children become old enough to operate
the appliance, it is the responsibility of the
parents/legal guardians to ensure the children
are instructed in safe practices by qualified
persons.
Proper Care and Maintenance
Remove the dishwasher door to the washing
compartment when removing an old
dishwasher for service or discarding.
To avoid floor damage and possible mold
growth, do not allow wet areas to remain
around or under the dishwasher.
Note: To avoid dishwasher damage, do not allow water to remain in your dishwasher systems through extended periods of freezing temperatures. Freezing temperatures can damage the water fill valve and potentially other components of your dishwasher.
NOTICE: It is highly recommended for the end user to become familiar with the procedure to shut off the incoming water supply and the procedure to shut off the incoming power supply. See the Installation Instructions or contact your installer for more information.
9 WARNING
Risk of explosion!
Under certain conditions, hydrogen gas
may be produced in a hot water system
that has not been used for two weeks or
more. Hydrogen gas is explosive. Before
using a dishwasher that is connected to a
hot water system that has been unused
for two weeks or longer, turn on all hot
water faucets and let the water flow from
each for several minutes. This will release
any accumulated hydrogen gas. As the
gas is explosive, do not smoke or use an
open flame during this time.
Proposition 65 Warning:
This product may contain a chemical known to
the State of California, which can cause
cancer or reproductive harm. Therefore, the
packaging of your product may bear the
following label as required by California:
67$7(2)&$/,)251,$352326,7,21:$51,1*
:$51,1*
&DQFHUDQG5HSURGXFWLYH+DUPZZZ3:DUQLQJVFDJRY
9
en-us Causes of Damage
ƒ
Causes of Damage
Causes of Damage
NOTICE: ▯Never use steam cleaning products to clean
your dishwasher. The manufacturer will not be liable
for the possible damages or consequences.
▯ To avoid possible dishwasher damage, do not use
harsh chemicals, abrasive cleaners, scouring pads
(metal or plastic), or abrasive cloths/paper towels to
clean your dishwashers exterior door panel. Your
dishwasher's exterior door panel can be damaged by
doing so.
▯ To avoid dishwasher damage, do not load the
dishwasher with paper products, plastic bags,
packing materials or anything other than normal,
dishwasher safe dishware and kitchenware.
▯ Protect your dishwasher from the elements. Protect
against freezing to avoid possible damage to the fill
valve. Damage caused by freezing is not covered by the
warranty.
10
*
Getting Started
Getting Started
Appliance overview
Getting Started en-us
VHF
K
PLQ
67$57
UHVHWVHF
UHVHWVHFVHFW
The dotted lines show optional features which may or
may not be included with your dishwasher.
11
en-us Getting Started
The numbers stated below refer to the overview images
on the previous page of this manual.
Operating panel
( On/Off button
0 Wash cycles**
8 Info button (
@ Digital display
H Rinse aid refill indicator
P Salt refill indicator
X Selection buttons
` Delay start / < button
h Remote start / > buttton
)" Wash cycle options**
)* START button
** the wash cycles and options will vary by model
Dishwasher interior components
1" Interior light *
1* Third rack
12 Upper rack
1: Upper spray arm
1B Detergent tab tray
1J Intake opening
1R Zeolite outlet cover (zeolite container)
1Z Lower spray arm
1b Dispenser for special salt
1j Filters
9" Silverware basket *
9* Lower rack
92 Rinse aid dispenser
9: Detergent dispenser
9B Lock for detergent dispenser
9J Rating plate
* optional feature which may or may not be included with
your dishwasher.
Display indicators
‹:‹‹ Cycle time remaining
% Lights up when rinse aid is low
$ Lights up when salt is low
| Lights up when wifi is connected
--------
Info button (
Info but t on
The Info button ( can be used to display additional wash
cycle information.
1. Press the Info button (8.
2. Press the wash cycle button.
Information on the selected wash cycle is indicated
on the display window at the top @.
3. To leave, press Info button ( 8.
Time setting
Ti me set t i ng
When the appliance is switched on for the first time, the
time starts at 12:00 o’clock.
Set the time as follows:
1. Open the door.
2. Switch on ON/OFF switch (.
3. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with t 3 sec.
4. Keep pressing button > ` until the time setting is
indicated on the display window at the top @.
5. Make the setting with setting buttons + - X. If the
selection buttons + - X are held down, the set
values are changed in 10-minute increments.
6. Press and hold the Info button (8 for 3 seconds.
12
The selected setting has now been stored.
Note: If the appliance was disconnected from the power supply for a prolonged period, the time starts at 12:00 o’clock. Set the time.
Getting Started en-us
Switching on the appliance for the first time
When you first turn on the dishwasher, you are taken
directly to the settings for switching on the appliance for
the first time. The following text is indicated on the
The required settings for switching on the appliance for
the first time are listed in the table below.
Change the setting as follows:
1. Keep pressing button > ` until the required setting
is displayed.
display window at the top @:
Scroll with < >
2. Make the selection with setting buttons + - X.
Set with + Leave with t 3 sec.
Settings
Switching on the
Factory setting Infotext
3. Press and hold the Info button (8 for 3 seconds.
The selected setting has now been stored.
by pressing Info button (
appliance for the first
time
Language American English Language selection.
Time format 24h 12h or 24h.
Time setting 12:00 Set the current time.
Water soft setting °E 0 - 8 soft Setting water hardness. When using Multitabs, select the
lowest setting.
Rinse aid setting Level 5 Amount of rinse aid affects drying.
--------
Settings
The dishwasher has been preset with certain settings
for your convenience. You can change these factory
setting.
Change the setting as follows:
1. Open the door.
2. Switch on ON/OFF switch (.
3. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with t 3 sec.
Setting Factory setting Infotext
Time setting 12:00 Set the current time.
Time format 24h 12h or 24h.
Time display Time Show end of wash cycle with display "Time" or "In hours".
Language American English Language selection.
Water hardness °E0-8 Soft Setting water hardness. When using Multitabs, select the
Rinse aid disp. Level 5 Amount of rinse aid affects drying.
Sensor setting Standard Adjusting water clarity detection for best cleaning results.
Extra dry Off Improved drying for glasses and plasticware.
* depending on the features of your dishwasher
4. Keep pressing button > ` until the required setting
is displayed.
5. Make the selection with setting buttons + - X.
6. Press and hold the Info button ( 8 for 3 seconds.
The chosen setting has now been stored.
You have the option of resetting all changed settings
back to the original factory settings.
Note: When you reset your dishwasher to the factory settings, you are taken directly to the settings for switching on the appliance for the first time.
by pressing Info button
lowest setting.
13
en-us Getting Started
Setting Factory setting Infotext
by pressing Info button
Eco forecast Off Show the water and energy consumption.
Auto Power Off Off Appliance automatically switches off at end of rinsing
process.
EmotionLight On Interior light.
Front display * On The front display can be selected.
Remaining time proj. * On While program is running, status information is projected
onto floor.
Infolight * On Light is projected to signal an active cleaning cycle.
Start Program Auto 130-150 °F When switching on, the last selected wash cycle appears.
Tone volume Level 2 Volume of signal at end of wash cycle.
Button volume Level 2 Volume when using buttons.
Child-proof lock * Off Activated child-proof lock impedes opening of door.
WLAN on/off Switch wireless network connection on or off.
Network login Manual or
Autom./ WPS
Check WPS function on router. WLAN must be turned on for
this setting to appear.
No WPS function: Manual
WPS function: Automatic
Connect to App Start with + Connect appliance to mobile terminal device. Appliance must
be connected to the network for this setting to appear.
Greeting On When switching on the appliance, the brand logo can be
deselected.
Factory setting Reset Resetting to the factory setting.
* depending on the features of your dishwasher
Notes
▯ The “Network login” menu option is only available if
WLAN has been switched on.
▯ The “Connect to App” menu option is only available if
a connection to the home network has been
established.
--------
14
Getting Started en-us
Home Connect™ System
This dishwasher is Wi-Fi capable and can be remotely
controlled via a mobile device.
If your dishwasher does not connect to the home
network, you can also operate the dishwasher manually
by pressing the buttons.
Refer to appliance overview for the location of the
buttons. ~ "Appliance overview" on page 11
Setting up the app
To be able to operate the appliance via Home Connect,
the Home Connect app must be installed on your mobile
device.
Observe the supplied Home Connect documents with
regard to this.
Follow the steps specified by the app to implement the
settings.
WLAN |
In the WLAN menu you can activate the wireless
network connection with “on” and deactivate it with
“off”.
Notes
▯ If you have selected the Wi-Fi “off” setting, the
“Network login” and “Connect to App” settings are
not available.
▯ Remote control of the appliance requires a stable
wireless network connection.
Network login
In the “Network login” menu you can select between
“Automatic/WPS” and “Manual” to connect the
dishwasher to your home network. To do this, test the
WPS function on your router.
Refer to Home Connect leaflet for detailed instructions.
Automatic: Connect to the home network using the WPS
function of your router.
Setting up Home Connect
You can set your dishwasher by pressing the remote
start button h or proceed as follows:
1. Open the door.
2. Switch on the On/Off switch (.
3. Press Info button 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with Setup 3 sec.
4. Keep pressing button > h until the required setting
is indicated on the display window at the top @.
5. Make the setting with setting buttons + - X. See
table in section
6. Press and hold the Info button 8 for 3 seconds.
The chosen setting has now been stored.
Manual: Connect your mobile device to the Home
Connect network. The network settings are then
manually entered using the Home Connect App to
connect to your home network.
Following successful connection, the following text is
indicated on the display window at the top @:
“Network login successful”.
Note: The “Network login” menu item is not available unless you have activated WLAN.
Connect to App
The “Connect to App” menu option is not available
unless there was a connection to the home network.
The “Connect to App” setting establishes the link
between the dishwasher, App and your user account.
Following successful connection, the following text is
indicated on the display window at the top @:
“Connection to app successful”.
Refer to the Home Connect leaflet for further
information.
15
en-us Water softening system / special salt
Remote start button
Once the dishwasher is connected to the home network,
press the remote start button h to control the
dishwasher from your device.
If the dishwasher has still not logged into Home
Connect, access the Home Connect settings by
pressing the remote start button h.
Follow the directions in the supplied Home Connect
leaflet.
Note: Your dishwasher is protected against unintentional operation. If the appliance door remains open for more than 4 seconds after pressing the Remote Start buttonh, the operation will be paused. Press the Remote Start button h again and close the appliance door to resume control. Also see section
Notes
▯ When the login process is complete, the Remote
Start button h goes out.
▯ To activate the remote control, press the Remote
Start button h.
▯ If the Home Connect Assistant was aborted during
start-up, press the Remote Start button h again.
▯ If the connection to the router fails, | flashes on the
display.
+
Water softening system / special salt
Water softening system / special salt
To ensure good rinsing results, the dishwasher requires
soft water, i.e. water which is low in lime, otherwise
limescale will be deposited on the utensils and interior
container. Tap water above 7° dH (1.2 mmol/l) must be
softened. The water is softened with special salt
(regeneration salt) in the water softening system
of the dishwasher. The setting and therefore the
required amount of salt depends on the degree of
hardness of your tap water (see following water
hardness table).
Water hardness table
:DWHU
KDUGQHVV
YDOXH(
Ȣ
Ȣ
Ȣ
Ȣ
+DUGQHVV
UDQJH
VRIW
VRIW
PHGLXP
PHGLXP
PPROO
Ȣ
Ȣ
Ȣ
Ȣ
6HWYDOXH
RQWKH
PDFKLQH
Wi-Fi without a connection to the Home Connect server ƒ
Wi-Fi without a connect i on to the Home Connect ser ver
You can use the Home Connect App to disconnect
from the Home Connect server.
The appliance is then locally connected to your mobile
device without any connection to the Home Connect
server.
Note: If you did not deactivate the connection to the Home Connect server, check your Internet connection.
Remote diagnosis ~
Remot e di agnos i s
Customer Service can use Remote Customer Service~
to access your appliance if you contact them.
Notes
▯ You have to confirm Customer Service access on
your appliance.
▯ You can switch off Remote Customer Service ~
using the On/Off switch ( or deactivate Customer
Service access in the Home Connect App.
Ȣ
Ȣ
Ȣ
Ȣ
PHGLXP
KDUG
KDUG
KDUG
Ȣ
Ȣ
Ȣ
Ȣ
16
Water softening system / special salt en-us
Adjusting the water softening system
The amount of salt dispensed can be set from 0 to 62°E.
Salt is not required at the set value 0-8.
Set the softening system as follows:
1. Ask your local water utility company for the water
hardness value of the tap water.
2. Required setting can be found in the water hardness
table.
3. Open the door.
4. Switch on ON/OFF switch (.
5. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with t 3 sec.
6. Keep pressing button > ` until the water hardness
is indicated on the display window at the top @.
Top off the salt as follows:
1. Undo the screw plug on the dispenser 1b.
2. Fill the dispenser with water (required only when
switching on the appliance for the first time).
3. Add salt as illustrated (do not use table salt or tablets).
The water is displaced and runs out.
For more information about buying dishwasher salt,
please contact Customer Service 1-800-944-2904.
7. Make the selection with setting buttons + - X.
8. Press and hold the Info button (8 for 3 seconds.
The chosen setting has now been stored.
Using special salt
As soon as the low salt indicator P lights up on the
digital display, salt should be topped off. Refilling the
salt dispenser should be done before switching on the
appliance. This ensures that extra salt water is washed
out and will not corrode the rinsing tank.
NOTICE: Detergent will destroy the water softening system! Never pour detergent into the salt dispenser.
Using detergents with salt component
Det er gent with a sal t component
If combined detergents with a salt component
are used, special salt can usually be omitted up
to a water hardness of 21° dH (37° fH, 26° Clarke,
3.7 mmol/l). If the water hardness is over 21° dH, salt
must be used.
Switching off low salt indicator / water softening system
Switching of f water soft eni ng syst em
If the use of combined detergents with a salt
component impairs the low salt indicator P on the
control panel or the text on the display window at the
top @ (enough salt for x rinse cycles), the displays
can be switched off.
Proceed as described under “Setting water softening
system” and set the value to 0-8. The water softening
system and salt refill indicator are now switched off.
17
en-us Rinse Aid
,
Rinse Aid
Rinse Aid
As soon as the low rinse aid indicator H lights up on
the control panel, rinse aid should be topped off.
The rinse aid is required for stain-free utensils and clear
glasses. Use only rinse aid which the manufacturer
designates as safe to use in domestic dishwashers.
Combined detergents with rinse aid component may be
used with soft to moderately hard water only (0-2 bands
on test strip or up to an °E value of 20). For moderately
hard to hard water (3 to 4 bands on test strip or °E value
of 21 or higher), rinse aid must be used.
Adding rinse aid
NOTICE: To avoid oversudsing or clogging, do not overfill the rinse aid dispenser 92. Wipe up any spills with a damp cloth.
1. Open the rinse aid dispenser 92 by pressing on the
latch of the lid and pulling it open.
3. Close the lid. Lid must be fully closed until it clicks in
order to seal.
4. Wipe up any excess rinse aid that may have puddled
when the dispenser reservoir is full.
This prevents excessive frothing during the next wash
cycle. The indicator light will go out a few moments
after the dishwasher door is shut.
Tip: For easier pouring, remove lid from the rinse aid bottle.
NOTICE: Do not fill the rinse aid dispenser 92 with detergent. Doing so will damage the dishwasher.
Setting the amount of rinse aid used
The amount of rinse aid to be dispensed can be set from
0 to 6. Set the amount of rinse aid to be dispensed to 5
to obtain a very good drying result. Do not change the
amount of rinse aid unless there are streaks or water
stains on the utensils. Set a lower level to avoid streaks.
Set a higher level to avoid water stains.
2. Add liquid rinse aid to the dispenser 92 until it is
full. Do not overfill. Avoid spilling into air vent hole.
PD[
BJS
WFOU
Set the amount of rinse aid as follows:
1. Open the door.
2. Press on ON/OFF button (.
3. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with t 3 sec.
4. Keep pressing button > ` until the rinse aid
dispenser is indicated on the display window at the
top @.
5. Make the selection with setting buttons + - X.
6. Press and hold the Info button (8 for 3 seconds.
The chosen setting has now been stored.
Note: Do not change the amount of rinse aid unless there are streaks (select lower setting) or water stains (select higher setting) visible on the utensils.
18
Loading the Dishwasher en-us
Switching off rinse aid refill indicator
If the use of combined detergents with a rinse aid
component impairs the low rinse aid indicator H on
the control panel (enough rinse aid for x rinse cycles),
the displays can be switched off.
Proceed as described under “Setting amount of rinse
aid” and select setting 0.
NOTICE: Using no rinse aid or setting the dispenser to 0 may result in longer cycle times consuming more energy and water. The higher temperatures can damage fine china or glassware.
-
Loading the Dishwasher
Loading the Dishwasher
Dishware material
Note: Before using your dishwasher for the first time,
check the information in this section. Some items are
not dishwasher-safe and should be hand washed; others
require special loading.
Recommended Precaution
Aluminum Colored anodized aluminum may
fade over time. Minerals in your
water may cause the aluminum to
darken or spot. This can usually
be removed with a soap-filled
steel wool pad.
China, Crystal,
Stoneware
Some hand-painted utensils may
discolor, fade or spot. Hand wash
these utensils. Position fragile
glassware so that it will not topple
over or come in contact with other
utensils during the wash cycle.
Glass Make sure to use dishwasher-
safe glass. Milk glass may
discolor or become yellow.
Non-stick Coatings Apply a light coating of vegetable
oil to non-stick surfaces after
drying.
Plastics Make sure the plasticware is
dishwasher-safe.
Stainless Steel,
Sterling Silver and
Silver Plates
Load these so they do not come
in contact with other metals,
stainless steel dishwasher tank
walls or the inner door.
Not
Reason
Recommended
Acrylic Crazing or small cracks
throughout the acrylic, may occur.
AdhesiveJoined Pieces
Adhesives that join materials such
as plastic, wood, bone, steel,
copper, tin, etc. may loosen.
Bone-Handled
Handles may separate.
Utensils
Iron Iron will rust. Hand wash and dry
immediately.
Non-Dishware
Items
Your dishwasher is intended for
use in cleaning ONLY standard
household dishware and
kitchenware.
Pewter, Brass,
Bronze
These items will tarnish. Hand
wash and dry immediately.
19
en-us Loading the Dishwasher
Glass and silverware damage
Causes:
▯ Glass type.
▯ Type of dishwasher detergent.
▯ Water temperature of the wash cycle.
Recommendation:
▯ Use only glasses and porcelain which
the manufacturer designates as dishwasher-safe.
▯ Use a detergent which protects silverware.
▯ Use less intensive wash cycles and take glass and
silverware out of the dishwasher as soon as possible
after the wash cycle ends.
Loading the racks
For best dishwashing results, observe the following
when loading the dishwasher:
▯ Do not pre-wash items with loosely attached food
soil.
▯ Remove all food particles, bones, toothpicks and
excessive grease.
▯ Pre-treat items having burned-on, baked-on or
starchy soils.
▯ Load dishes in the dishwasher racks so the insides
of bowls, pots and pans are facing the spray arms.
▯ Avoid nesting and contact points between dishes.
▯ Separate items of dissimilar metals. Use care to not
block movement of the spray arms.
▯ Only wash household dishware and kitchenware
rated as dishwasher-safe.
Refer to the Dishware Materials section for more
information about dishware suitability.
NOTICE: To avoid dishwasher damage, do not load the dishwasher with paper products, plastic bags, packing materials or anything other than normal, dishwasher safe dishware and kitchenware.
Loading the upper rack
Ensure items do not protrude through the bottom of the
racks and block the spray arms.
Note: When pushing the upper rack 12 into the dishwasher, push it until it stops against the back of the tub so the upper rack spray arm 1: connects to the water supply at the back of the tub. Do not push racks in using the door.
Loading the lower rack
Place large items in the lower rack 9*. Load pots, pans
and bowls upside down. Do not block the vent hole with
tall baking sheets. Load these items on the right side of
the dishwasher.
20
Loading the Dishwasher en-us
Recommended loading pattern
Note: Folding the cup shelves down will allow the cups
to sit at an increased angle and reduce water pooling on
cup bottoms.
Lower rack - 12 place setting
Lower rack - 10 place setting
Upper rack - 10 place setting
Upper rack - 12 place setting
Third rack - 12 place setting
Third rack - 10 place setting
21
en-us Loading the Dishwasher
Loading the silverware basket
Place knives and sharp utensils with their handles up
and forks and spoons with their handles down. If large
or oddly-shaped items are loaded in the silverware
basket, be sure they do not nest together.
9 WARNING
Risk of injury!
The sharp points and edges of knives and other
sharp utensils can cause serious injury. Load
knives and other sharp utensils with edges down.
Do not allow children to handle or play near
knives and sharp utensils.
Suggested loading patterns
1 Salad fork
2 Teaspoon
3 Dinner fork
4 Knife
5 Tablespoon
6 Serving spoon
7 Serving fork
* optional feature which may or may not be included with
your dishwasher.
22
Loading the Dishwasher en-us
Rack accessories
Third rack*
The third rack 1* horizontally positions knives,
spatulas and other oversized tools for improved
cleaning and easier loading and unloading. Arrange
cutlery in third rack 1* as illustrated.
Depending on the features of your dishwasher, you can
fold down the side shelves to provide more room for
taller items of silverware. The front rows of prongs can
be folded down to provide room for wider handles.
Cup shelves*
The cup shelves and the space underneath can be used
for small cups and glasses or for larger items of
silverware, such as wooden spoons or serving spoons
or forks. If you do not require the cup shelf, it can be
folded up.
&/,&.
Adjust the height of the cup shelves as follows:
1. Position the cup shelf vertically and pull upwards.
2. Push cup shelf at a slight angle downwards to the
required height (1, 2, or 3).
&/,&.
3. Engage cup shelf.
Cup shelf “clicks” into position.
* optional feature which may or may not be included with
your dishwasher.
* optional feature which may or may not be included with
your dishwasher.
23
en-us Loading the Dishwasher
Flip tines*
Depending on the features of your dishwasher, the tines
can be folded down. This facilitates arrangement of
pots, bowls and glasses..
Fold down the flip tines as follows:
1. Pull flip tine gently forward and release it from the
notch (1).
2. Push the flip tine downward to the desired
position (2).
Extra tall item sprinkler*
Large trays or grills as well as large plates (gourmet
plates, pasta plates, dinner plates) can be cleaned with
this spray head.
Insert the spray head as follows:
1. Remove upper rack 12.
2. Insert spray head as illustrated and turn to the right.
Spray head is engaged.
To fold up, push flip tines into an upright position until
the holder engages in the notch.
* optional feature which may or may not be included with
your dishwasher.
Plastic item clips*
Light-weight plastic accessories (cups, lids, etc.) can be
held securely by the plastic item clips.
Press the plastic item clip against the rack as shown
until it clicks.
&/,&.
Notes
▯ Keep the vent hole on the tub’s left side clear by
placing tall items such as plastic cutting boards and
tall baking sheets on the lower rack’s right side or
center.
▯ Ensure that the dishwasher is always operated with
upper rack 12 or extra tall item sprinkler.
To ensure that the spray jet can reach all parts, arrange
the baking sheets as illustrated (max. 2 baking sheets
and 2 grills).
NOTICE: To avoid dishwasher damage, do not reinstall the upper rack 12 without removing the extra tall item sprinkler (B).
* optional feature which may or may not be included with
your dishwasher.
* optional feature which may or may not be included with
your dishwasher.
24
Loading the Dishwasher en-us
Gastronorm insert *
Gastr onorm insert
Helps you stack several Gastronorm drawers, trays
or similar large flat utensils at an angle in the lower
rack.
You can remove the insert if required.
* optional feature which may or may not be included with
your dishwasher.
Adjusting the height of the rack *
Adj us t i n g the hei ght of the rack
If required, the height of the upper rack 12 can be
adjusted to create more space for taller utensils either
in the upper or lower rack.
Appliance height 32 in (81.5 cm)
With silverware basket
Setting 1 max. ø 8.6 in (22 cm) 12.2 in (31 cm) Setting 2 max. ø 9.6 in (24.5 cm) 10.8 in (27.5 cm) Setting 3 max. ø 10.6 in (27 cm) 9.8 in (25 cm)
With third rack Upper rack Lower rack
Setting 1 max. ø 6.3 in (16 cm) 12.2 in (31 cm) Setting 2 max. ø 7 in (18.5 cm) 10.8 in (27.5 cm) Setting 3 max. ø 8.2 in (21 cm) 9.8 in (25 cm)
Appliance height 35 in (86.5 cm)
With silverware basket
Setting 1 max. ø 9.4 in (24 cm) 13.4 in (34 cm) Setting 2 max. ø 10.4 in (26.5 cm) 12 in (30.5 cm) Setting 3 max. ø 11.4 in (29 cm) 11 in (28 cm)
Upper rack Lower rack
Upper rack Lower rack
Unloading the dishwasher
When unloading the dishwasher, it is recommended to
unload the lower rack first. Next, unload the silverware
basket followed by the upper rack, and then the third
rack.
Note: Dishes are more likely to chip when unloading before cooling.
With third rack Upper rack Lower rack
Setting 1 max. ø 7 in (18 cm) 13.4 in (34 cm) Setting 2 max. ø 8 in (20.5 cm) 12 in (30.5 cm) Setting 3 max. ø 9 in (23 cm) 11 in (28 cm)
Arrange large plates up to a diameter of 12.2 in/13.4* in
(31/34* cm) in the lower basket 9* as illustrated.
* optional feature which may or may not be included with
your dishwasher.
25
en-us Loading the Dishwasher
Upper rack with side levers
1. Pull out upper rack 12.
2. Hold the sides of the rack along the upper edge.
This prevents it from suddenly dropping.
3. To lower the upper rack; press in both levers on the
left and right on the outside of the rack. The upper
rack lowers.
Removing third rack 1*:
1. Pull out third rack all the way (1).
2. Lift front of the third rack out of the catch (2).
3. Pull out third rack forwards and lower (3).
4. To lift the upper rack; grip the sides of the upper rack
along the upper edge and lift.
5. Ensure that both sides of the upper rack are at the
same height.
6. Push in upper rack.
Removing/Installing third rack
Installing third rack 1*
1. Pull out third rack rails all the way (1).
2. Insert third rack (2). In doing so, note the position of
the detent pins (as illustrated in Step 2).
3. Lift third rack slightly and insert rear detent pins into
the lower locking hooks on the rails (3).
4. Lower third rack and press the front detent pins into
the notch (4). Third rack “clicks” into position.
5. Push in third rack.
26
Loading the Dishwasher en-us
Removing/Installing upper rack *
Removing upper rack 12:
1. Pull out upper rack all the way (1).
2. Lift front of the upper rack out of the catch (2).
Installing upper rack 12:
1. Pull out upper rack rails all the way (1).
2. Insert upper rack (2). In doing so, note the position
of the detent pins (as illustrated in Step 2).
3. Lift upper rack slightly and insert rear detent pins
into the locking hooks (3).
4. Lower upper rack and press into the front notch (4).
Upper rack “clicks” into position.
5. Push in upper rack.
3. Pull out upper rack forwards and lower (3).
27
en-us Loading the Dishwasher
Removing/Installing lower rack
Removing lower rack 9*:
1. Pull out lower rack all the way (1).
Installing lower rack 9*:
1. Pull out lower rack rails all the way (1).
2. Insert lower rack into the rear holders (2).
3. Lower lower rack at the front and place in the front
holders (3).
4. Push in lower rack.
2. Lift lower rack first out of the front and then out of
the rear holders (2).
28
Detergent en-us
.
Detergent
Detergent
Use only detergent specifically designed for
dishwashers. For best results, use fresh powdered
dishwashing detergent or detergent tabs.
NOTICE: To avoid damage to dishwasher or dishware:
▯ Do not use hand dishwashing products in your
dishwasher.
▯ Do not use too much detergent if your water is soft.
Using too much detergent with soft water may cause
etching in glassware and fine china.
▯ To best protect glassware, use a wash cycle with low
temperatures or a specific glass-care cycle
(depending on the model) and use a detergent that
includes etch protection.
Note: If you do not know the hardness of your water supply, use 15 ml of detergent. Increase the amount if necessary to the least amount required to get your kitchenware clean.
3. Dosage: see manufacturer’s instructions on
the packaging. Use graduated detergent dispenser.
Usually 1¼ to 1½ tablespoons (20 ml–25 ml) are
adequate for normal soiling. If using tablets, one
tablet is adequate.
êWEVS
PO
êWEVS
PO
WEVS
PO
4. Close cover on the detergent dispenser.
Cover “clicks” into position.
&/,&.
Adding detergent
1. If the detergent dispenser 9: is still closed, actuate
locking bar 9B to open it.
2. Pour detergent into the dry detergent dispenser 9:
only. Do not overfill the detergent dispenser.
When using detergent tabs, lay them such that they
do not come in contact with the cover, insert a
detergent tab flat, not on its side.
Note:Do not place detergent tabs in the tab tray 1B. Place tabs or other detergent forms directly in the detergent dispenser 9:.
The detergent dispenser opens automatically at the
optimum time depending on the wash cycle. The
powder or liquid detergent is distributed in the
appliance and is dissolved, the detergent tab falls
into the detergent tab tray where it dissolves in
doses.
Tip: If the utensils are only lightly soiled, slightly less than the indicated amount of detergent is usually adequate.
Suitable detergents and care products can be
purchased online via our website or via customer
service (see back page).
29
en-us Detergent
Combination detergent
Apart from conventional single function detergents, a
number of products are offered with additional
functions. These products contain not only the
detergent but also rinse aid and salt replacement
substances (3in1) and, depending on the combination
(4in1, 5in1, ...), additional components such as glass
protection or stainless steel cleaner. Combination
detergents function only up to a specific degree of
hardness (usually 21°dH). Over this limit salt and rinseaid must be added.
As soon as combined detergents are used, the rinse
programme is adjusted automatically to ensure the best
possible rinsing and drying result.
Notes
▯ If you want to add more utensils after the wash cycle
has started, do not use the detergent tab tray 1B as
a handle for the upper rack. The detergent tab could
already be there and you will touch the partially
dissolved tab.
▯ Do not place small parts for washing in the detergent
tab tray 1B; this prevents the detergent tab from
dissolving evenly.
▯ You will obtain optimum rinsing and drying results
by using single function detergents and applying salt
and rinse aid separately.
▯ If wash cycles are short, detergent tabs may not have
full cleaning effect due to different dissolving
properties and there may even be undissolved
detergent residue. It is recommended to use washing
powder for these wash cycles.
▯ The dosing of a detergent tab is adequate for the
“Intensive” wash cycle (for some models). When
using washing powder, you can apply some of this
cleaning agent to the inside of the appliance’s door.
▯ Even if the rinse-aid and/or salt refill indicator is lit,
the rinse cycle will run correctly with combined
detergents.
▯ If using detergents in a water-soluble protective
cover: Take hold of the cover with dry hands only
and put the detergent into an absolutely dry
detergent dispenser only, otherwise the detergent
may stick.
▯ If you switch from combined detergents to single
function detergents, ensure that the water softening
system and amount of rinse aid have been set to
the correct value.
▯ Biological/eco detergents: Detergent products
identified as “Bio” or “Eco” (to protect the
environment) usually use lower quantities of active
agents or completely dispense with certain
substances. The cleaning effect of such products
may occasionally be restricted.
30
Loading...