Gaggenau DF250761 Instructions for Use
*DJJHQDX
en-us Operating instructions
fr-ca Notice d'utilisation
Dishwasher
DF250/DF251
2
Table of contents
en-us Operating instructions
(
Safety Definitions 6
(
IMPORTANT SAFETY INSTRUCTIONS 7
Risk of fire, electrical shock, or serious injury 7
GROUNDING INSTRUCTIONS 8
Safe Operation 8
Child Safety 9
Proper Care and Maintenance 9
ƒ
Causes of Damage 10
*
Getting Started 11
Appliance overview 11
Operating panel 12
Dishwasher interior components 12
Info button 12
Time setting 12
Switching on the appliance for the first time 13
Settings 14
+
Water softening system / special salt 15
Water hardness table 15
Adjusting the water softening system 15
Using special salt 16
Detergent with a salt component 16
Switching off water softening system 16
,
Rinse Aid 17
Adding rinse aid 17
Setting the amount of rinse aid used 17
Switching off rinse aid refill indicator 18
-
Loading the Dishwasher 18
Dishware material 18
Glass and silverware damage 19
Loading the racks 19
Recommended loading pattern 20
Loading the silverware basket 21
Rack accessories 22
Unloading the dishwasher 24
Adjusting the height of the rack 24
Upper rack with side levers 25
Removing/Installing upper rack with Rackmatic®*25
en-us
.
Detergent 26
Adding detergent 26
Combination detergent 27
/
Dishwasher Cycles 28
0
Dishwasher Cycle Options 29
Intensive Zone 29
Power 29
Wash Cycle Information 29
1
Operating the Dishwasher 30
Protection against unintentional operation 30
Operating the touch buttons 30
Opening the door 30
Changing the settings 30
AquaSensor 31
Time display 31
Sensor setting 31
extraDry 31
Eco forecast 31
Auto Power Off 31
infoLight 31
Changing start wash cycle 32
Tone volume 32
Button volume 32
Child-proof lock 32
Greeting 32
Factory setting 32
Switching the appliance on 32
Delay start time 32
Wash cycle end 33
Switching off the appliance 33
Interrupting the wash cycle 33
Terminating the wash cycle 33
Changing the wash cycle 33
2
Care and Maintenance 34
Cleaning the dishwasher 34
Special salt and rinse aid 34
Filters 35
Spray arms 36
Drain pump 37
Preparing your unit for vacation 37
Winterizing your unit 37
3
en-us
3
Troubleshooting 38
Error message 38
Fault table 38
4
Customer Service 45
‡
Statement of Limited Product Warranty 45
What this Warranty Covers & Who it Applies to: 45
How Long the Warranty Lasts 45
Repair/Replace as Your Exclusive Remedy 46
Out of Warranty Product 46
Warranty Exclusions 46
How to Obtain Warranty Service 47
5
Installation and connection 47
Parts included 47
Safety instructions 47
Delivery 48
Technical specifications 48
Installation 48
Drain connection 48
Water supply connection 49
Hot water connection 49
Electrical connection 50
Removing the appliance 50
Transporting the appliance 51
Securing the appliance against frost 51
4
en-us
&RQJUDWXODWLRQVDQG7KDQN<RXIURP*DJJHQDX
7KDQN\RXIRUVHOHFWLQJD*DJJHQDXGLVKZDVKHU<RXKDYHMRLQHGWKHPDQ\FRQVXPHUV
ZKRGHPDQGTXLHWDQGVXSHULRUSHUIRUPDQFHIURPWKHLUGLVKZDVKHUV
7KLVPDQXDOZDVZULWWHQZLWK\RXUVDIHW\DQGFRQYHQLHQFHLQPLQGDQGWKHLQIRUPDWLRQFRQWDLQHGKHUHLQLVYHU\LPSRUWDQW
:HKLJKO\UHFRPPHQGWKDW\RXUHDGWKLVPDQXDOEHIRUH\RXXVH\RXUGLVKZDVKHUIRUWKHILUVWWLPH
7ROHDUQHYHQPRUHDERXW\RXUGLVKZDVKHUDQGDYDLODEOHDFFHVVRULHVDVZHOODVPDQ\RWKHUWRSTXDOLW\
*DJJHQDXDSSOLDQFHVYLVLWRXUZHEVLWHDWZZZJDJJHQDXXVDFRP
3OHDVHFRQWDFWXVLI\RXKDYHDQ\TXHVWLRQVRUFRPPHQWV
*DJJHQDX
0DLQ6WUHHW6XLWH
,UYLQH&$
86$
3KRQH
LQIR#JDJJHQDXXVDFRP
ZZZJDJJHQDXXVDFRP
5
en-us Safety Definitions
(
Safety Definitions
Safety Definitions
9 WARNING
This indicates that death or serious injuries may
occur as a result of non-observance of this
warning.
9 CAUTION!
This indicates that minor or moderate injuries may
occur as a result of non-observance of this
warning.
NOTICE: This indicates that damage to the appliance or property may occur as a result of non-compliance with this advisory.
Note: This alerts you to important information and/or tips.
6
9 IMPORTANT SAFETY INSTRUCTIONS
READ AND SAVE THESE INSTRUCTIONS
(
IMPORTANT SAFETY INSTRUCTIONS
This dishwasher is provided with Installation
Instructions and this Use and Care Manual.
Read and understand all instructions before
using the dishwasher.
This dishwasher is intended for use up to a
maximum altitude of 13,000 ft (4,000 meters)
above sea level.
To reduce the risk of fire, electrical shock, or serious injury, observe the following:
Risk of fire, el ect r i cal shock, or seri ous injury
9 WARNING
9 WARNING
Risk of electrical shock or fire!
Electrical shock or fire could result if the
electrical supply for the dishwasher
covered in this manual is incorrectly
installed or if the dishwasher has been
improperly grounded. Do not use the
dishwasher covered in this manual unless
you are certain the electrical supply has
been correctly installed and the
dishwasher has been properly grounded.
Risk of injury or death!
Misuse of the dishwasher can result in
serious injury or death. Do not use the
dishwasher in any way not covered in this
manual or for any purpose other than
those explained in the following pages.
9 WARNING
Risk of injury!
Severe injury and/or product damage
could result from the use of unauthorized
service technicians or non-original
replacement parts. All repairs must be
performed by an authorized service
technician using only original equipment
factory replacement parts.
9 WARNING
Health hazard!
Never use harsh chemicals to clean your
dishwasher. Some bleach-based products
can damage your dishwasher and may
present health hazards!
7
9 IMPORTANT SAFETY INSTRUCTIONS
READ AND SAVE THESE INSTRUCTIONS
GROUNDING INSTRUCTIONS
This appliance must be grounded to a metal,
permanent wiring system or an equipment
grounding conductor must be run with the
circuit conductors and connected to the
equipment grounding terminal or lead on the
dishwasher. See the Installation Instructions
included with this dishwasher for more
information on electrical requirements.
9 WARNING
Risk of electric shock!
This appliance must be grounded. In the
event of a malfunction or breakdown,
grounding will reduce the risk of electric
shock by providing a path of least
resistance for electric current. This
appliance is equipped with a cord having
an equipment-grounding conductor.
Improper connection of the equipmentgrounding conductor can result in risk of
electric shock. Check with a qualified
electrician if you are in doubt whether the
appliance is properly grounded.
Safe Operation
Use this dishwasher only for its intended
function, which is the washing of household
dishware and kitchenware rated as dishwasher
safe.
Use only detergents or rinsing agents
recommended for use in a dishwasher, and
keep them out of the reach of children.
9 CAUTION!
When loading items to be washed:
■ Locate sharp items so they are not
likely to damage the door seal.
■ Load knives and other sharp utensils
with their HANDLES UP to reduce the
risk of cut-type injuries.
■ Do not wash plastic items unless they
are marked “dishwasher safe” or the
equivalent. For plastic items not so
marked, check the manufacturer’s
recommendations.
■ Do not operate your dishwasher unless
all enclosure panels are in place.
■ Do not tamper with or override
controls and interlocks.
Do not abuse, sit or stand on the door or dish
racks of the dishwasher.
9 WARNING
Risk of injury!
To avoid risk of injury, always use caution
when opening the door during or
following a wash cycle as hot water or
steam may escape. Do not fully open the
door until water noises have stopped and
steam has subsided.
8
9 IMPORTANT SAFETY INSTRUCTIONS
READ AND SAVE THESE INSTRUCTIONS
To reduce risk of injury, do not allow
children to play in or on the dishwasher.
When children become old enough to
operate the appliance, it is the
responsibility of the parents/legal
guardians to ensure the children are
instructed in safe practices by qualified
persons.
NSF/ANSI 184 Certified residential
dishwashers are not intended for licensed
food establishments.
Child Safety
To reduce risk of injury, do not allow children
to play in or on the dishwasher.
When children become old enough to operate
the appliance, it is the responsibility of the
parents/legal guardians to ensure the children
are instructed in safe practices by qualified
persons.
Remove the dishwasher door to the washing
compartment when removing an old
dishwasher for service or discarding.
To avoid floor damage and possible mold
growth, do not allow wet areas to remain
around or under the dishwasher.
Note: To avoid dishwasher damage, do not allow water to remain in your dishwasher systems through extended periods of freezing temperatures. Freezing temperatures can damage the water fill valve and potentially other components of your dishwasher.
NOTICE: It is highly recommended for the end user to become familiar with the procedure to shut off the incoming water supply and the procedure to shut off the incoming power supply. See the Installation Instructions or contact your installer for more information.
State of California Proposition 65 Warning:
9 WARNING
Proper Care and Maintenance
9 WARNING
Risk of explosion!
Under certain conditions, hydrogen gas
may be produced in a hot water system
that has not been used for two weeks or
more. Hydrogen gas is explosive. Before
using a dishwasher that is connected to a
hot water system that has been unused
for two weeks or longer, turn on all hot
water faucets and let the water flow from
each for several minutes. This will release
any accumulated hydrogen gas. As the
gas is explosive, do not smoke or use an
open flame during this time.
This product can expose you to chemicals
including vinyl chloride, which is known
to the State of California to cause cancer
and birth defects or other reproductive
harm. For more information go to
www.P65Warnings.ca.gov.
9
en-us Causes of Damage
ƒ
Causes of Damage
Causes of Damage
NOTICE: ▯Never use steam cleaning products to clean
your dishwasher. The manufacturer will not be liable
for the possible damages or consequences.
▯ To avoid possible dishwasher damage, do not use
harsh chemicals, abrasive cleaners, scouring pads
(metal or plastic), or abrasive cloths/paper towels to
clean your dishwashers exterior door panel. Your
dishwasher's exterior door panel can be damaged by
doing so.
▯ To avoid dishwasher damage, do not load the
dishwasher with paper products, plastic bags,
packing materials or anything other than normal,
dishwasher safe dishware and kitchenware.
▯ Protect your dishwasher from the elements. Protect
against freezing to avoid possible damage to the fill
valve. Damage caused by freezing is not covered by the
warranty.
10
*
Getting Started
Getting Start ed
Appliance overview
Getting Started en-us
VHF
K
PLQ
UHVHWVHFVHFW
67$57
UHVHWVHF
The numbers stated below refer to the overview images
on the previous page of this manual.
11
en-us Getting Started
Operating panel
( On/Off button
0 Wash cycles**
8 Info button (
@ Digital display
H Rinse aid refill indicator
P Salt refill indicator
X Selection buttons
` Delay start button
h Wash cycle options**
)" START button
)* < > button
Note: Some of the wash cycles and options will vary by model.
Dishwasher interior components
1" Interior light *
1* Third rack*
12 Upper rack
1: Upper spray arm
1B Detergent tab tray
1J Lower spray arm
1R Dispenser for special salt
1Z Filters
1b Silverware basket *
1j Lower rack
9" Rinse aid dispenser
9* Detergent dispenser
92 Lock for detergent dispenser
9: Rating plate
* optional feature which may or may not be included with
your dishwasher.
Info button (
Info but t on
The Info button ( can be used to display additional wash
cycle information.
1. Press the Info button (8.
2. Press the wash cycle button.
Information on the selected wash cycle is indicated
on the display window at the top @.
3. To leave, press Info button ( 8.
Time setting
Ti me set t i ng
When the appliance is switched on for the first time, the
time starts at 12:00 o’clock.
Set the time as follows:
1. Open the door.
2. Switch on ON/OFF switch (.
3. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with t 3 sec.
4. Keep pressing button > )* until the time setting is
indicated on the display window at the top @.
5. Make the setting with setting buttons + - X. If the
selection buttons + - X are held down, the set
values are changed in 10-minute increments.
6. Press and hold the Info button (8 for 3 seconds.
The selected setting has now been stored.
Note: If the appliance was disconnected from the power supply for a prolonged period, the time starts at 12:00 o’clock. Set the time.
12
Getting Started en-us
Switching on the appliance for the first time
When the dishwasher is switched on for the first time,
you are taken directly to the settings for switching on
the appliance for the first time. The following text is
indicated on the display window at the top @:
Scroll with < >
Set with + -
Leave with t 3 sec.
Settings Switching on the appliance for the first time
Language American English Language selection.
Time format 24h 12h or 24h.
Time setting 12:00 Set the current time.
Water soft setting °E 0 - 8 soft Setting water hardness. When using Multitabs, select the
Rinse aid setting Level 5 Amount of rinse aid affects drying.
Factory setting Infotext
The required settings for switching on the appliance for
the first time are listed in the table below.
Change the setting as follows:
1. Keep pressing button > )* until the required setting
is displayed.
2. Make the selection with setting buttons + - X.
3. Press and hold the Info button (8 for 3 seconds.
The selected setting has now been stored.
by pressing Info button (
lowest setting.
13
en-us Getting Started
Settings
The dishwasher has been preset with certain settings
for your convenience. You can change these factory
4. Keep pressing button > )* until the required setting
is displayed.
setting.
5. Make the selection with setting buttons + - X.
Change the setting as follows:
6. Press and hold the Info button ( 8 for 3 seconds.
1. Open the door.
The chosen setting has now been stored.
2. Switch on ON/OFF switch (.
You have the option of resetting all changed settings
3. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
back to the original factory settings.
Note: When you reset your dishwasher to the factory settings, you are taken directly to the settings for switching on the appliance for the first time.
Set with - +
Leave with t 3 sec.
Setting Factory setting Infotext
by pressing Info button (
Time setting 12:00 Set the current time.
Time format 24h 12h or 24h.
Time display Time Show end of wash cycle with display "Finish in" or "Finish at".
Language American English Language selection.
Water hardness °E 0 Setting water hardness. When using Multitabs, select the lowest
setting.
Rinse aid disp. Level 5 Amount of rinse aid affects drying. When using Multitabs, select
setting 0.
Sensor setting Standard Adjustment of soiling detection for optimum cleaning result.
Extra dry Off Improved drying for glasses and plasticware.
Eco forecast Off Show the water and energy consumption.
Auto Power Off Off Appliance automatically switches off at end of rinsing process.
Emotion Light * On Interior light.
Front display * On The front display can be selected.
Remaining time proj. * On While wash cycle is running, status information is projected onto
floor.
Infolight * On Light is projected to signal an active wash cycle.
Start wash cycle Auto 130-150° F When switching on, the last selected wash cycle appears.
Tone volume * Level 2 Volume of signal at end of wash cycle.
Button volume Level 2 Volume when using buttons.
Child-proof lock * Off Activated child-proof lock impedes opening of door.
Eco drying * On Door opens automatically at the end of the wash cycle.
Greeting On When switching on the appliance, the brand logo can be
deselected.
Factory setting Reset Resetting to the factory setting.
* depending on the features of your dishwasher
14
Water softening system / special salt en-us
+
Water softening system / special salt
Water softening system / special salt
To ensure good rinsing results, the dishwasher requires
soft water, i.e. water which is low in lime, otherwise
limescale will be deposited on the utensils and interior
container. Tap water above 7° dH (1.2 mmol/l) must be
softened. The water is softened with special salt
(regeneration salt) in the water softening system
of the dishwasher. The setting and therefore the
required amount of salt depends on the degree of
hardness of your tap water (see following water
hardness table).
Water hardness table
:DWHU
KDUGQHVV
YDOXH(
Ȣ
Ȣ
Ȣ
Ȣ
Ȣ
Ȣ
+DUGQHVV
UDQJH
VRIW
VRIW
PHGLXP
PHGLXP
PHGLXP
KDUG
PPROO
Ȣ
Ȣ
Ȣ
Ȣ
Ȣ
Ȣ
6HWYDOXH
RQWKH
PDFKLQH
Adjusting the water softening system
The amount of salt dispensed can be set from 0 to 62°E.
Salt is not required at the set value 0-8.
Set the softening system as follows:
1. Ask your local water utility company for the water
hardness value of the tap water.
2. Required setting can be found in the water hardness
table.
3. Open the door.
4. Switch on ON/OFF switch (.
5. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with t 3 sec.
6. Keep pressing button > )* until the water hardness
is indicated on the display window at the top @.
7. Make the selection with setting buttons + - X.
8. Press and hold the Info button (8 for 3 seconds.
The chosen setting has now been stored.
Ȣ
Ȣ
KDUG
KDUG
Ȣ
Ȣ
15
en-us Water softening system / special salt
Using special salt
As soon as the low salt indicator P lights up on the
digital display, salt should be topped off. Refilling the
salt dispenser should be done before switching on the
appliance. This ensures that extra salt water is washed
out and will not corrode the rinsing tank.
NOTICE: Detergent will destroy the water softening system! Never pour detergent into the salt dispenser.
Top off the salt as follows:
1. Undo the screw plug on the dispenser 1R.
2. Fill the dispenser with water (required only when
switching on the appliance for the first time).
3. Add salt as illustrated (do not use table salt or tablets).
The water is displaced and runs out.
Using detergents with salt component
Det er gent with a sal t component
If combined detergents with a salt component
are used, special salt can usually be omitted up
to a water hardness of 21° dH (37° fH, 26° Clarke,
3.7 mmol/l). If the water hardness is over 21° dH, salt
must be used.
Switching off low salt indicator / water softening system
Switching of f wat er sof t eni ng syst em
If the use of combined detergents with a salt
component impairs the low salt indicator P on the
control panel or the text on the display window at the
top @ (enough salt for x rinse cycles), the displays
can be switched off.
Proceed as described under “Setting water softening
system” and set the value to 0-8. The water softening
system and salt refill indicator are now switched off.
For more information about buying dishwasher salt,
please contact Customer Service 1-800-944-2904.
16
Rinse Aid en-us
,
Rinse Aid
Rinse Aid
As soon as the low rinse aid indicator H lights up on
the control panel, rinse aid should be topped off.
The rinse aid is required for stain-free utensils and clear
glasses. Use only rinse aid which the manufacturer
designates as safe to use in domestic dishwashers.
Combined detergents with rinse aid component may be
used with soft to moderately hard water only (0-2 bands
on test strip or up to an °E value of 20). For moderately
hard to hard water (3 to 4 bands on test strip or °E value
of 21 or higher), rinse aid must be used.
Adding rinse aid
NOTICE: To avoid oversudsing or clogging, do not overfill the rinse aid dispenser 9". Wipe up any spills with a damp cloth.
1. Open the rinse aid dispenser 9" by pressing on the
latch of the lid and pulling it open.
3. Close the lid. Lid must be fully closed until it clicks in
order to seal.
4. Wipe up any excess rinse aid that may have puddled
when the dispenser reservoir is full.
This prevents excessive frothing during the next wash
cycle. The indicator light will go out a few moments
after the dishwasher door is shut.
Tip: For easier pouring, remove lid from the rinse aid bottle.
NOTICE: Do not fill the rinse aid dispenser 9" with detergent. Doing so will damage the dishwasher.
Setting the amount of rinse aid used
The amount of rinse aid to be dispensed can be set from
0 to 6. Set the amount of rinse aid to be dispensed to 5
to obtain a very good drying result. Do not change the
amount of rinse aid unless there are streaks or water
stains on the utensils. Set a lower level to avoid streaks.
Set a higher level to avoid water stains.
2. Add liquid rinse aid to the dispenser 9" until it is
full. Do not overfill. Avoid spilling into air vent hole.
PD[
BJS
WFOU
Set the amount of rinse aid as follows:
1. Open the door.
2. Press on ON/OFF button (.
3. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with t 3 sec.
4. Keep pressing button > )* until the rinse aid
dispenser is indicated on the display window at the
top @.
5. Make the selection with setting buttons + - X.
6. Press and hold the Info button (8 for 3 seconds.
The chosen setting has now been stored.
Note: Do not change the amount of rinse aid unless there are streaks (select lower setting) or water stains (select higher setting) visible on the utensils.
17
en-us Loading the Dishwasher
Switching off rinse aid refill indicator
If the use of combined detergents with a rinse aid
component impairs the low rinse aid indicator H on
the control panel (enough rinse aid for x rinse cycles),
the displays can be switched off.
Proceed as described under “Setting amount of rinse
aid” and select setting 0.
NOTICE: Using no rinse aid or setting the dispenser to 0 may result in longer cycle times consuming more energy and water. The higher temperatures can damage fine china or glassware.
-
Loading the Dishwasher
Loading the Dishwasher
Dishware material
Note: Before using your dishwasher for the first time,
check the information in this section. Some items are
not dishwasher-safe and should be hand washed; others
require special loading.
Recommended Precaution
Aluminum Colored anodized aluminum may
fade over time. Minerals in your
water may cause the aluminum to
darken or spot. This can usually
be removed with a soap-filled
steel wool pad.
China, Crystal,
Stoneware
Some hand-painted utensils may
discolor, fade or spot. Hand wash
these utensils. Position fragile
glassware so that it will not topple
over or come in contact with other
utensils during the wash cycle.
Glass Make sure to use dishwasher-
safe glass. Milk glass may
discolor or become yellow.
Non-stick Coatings Apply a light coating of vegetable
oil to non-stick surfaces after
drying.
Plastics Make sure the plasticware is
dishwasher-safe.
Stainless Steel,
Sterling Silver and
Silver Plates
Load these so they do not come
in contact with other metals,
stainless steel dishwasher tank
walls or the inner door.
18
Not
Reason
Recommended
Acrylic Crazing or small cracks
throughout the acrylic, may occur.
AdhesiveJoined Pieces
Adhesives that join materials such
as plastic, wood, bone, steel,
copper, tin, etc. may loosen.
Bone-Handled
Handles may separate.
Utensils
Iron Iron will rust. Hand wash and dry
immediately.
Non-Dishware
Items
Your dishwasher is intended for
use in cleaning ONLY standard
household dishware and
kitchenware.
Pewter, Brass,
Bronze
These items will tarnish. Hand
wash and dry immediately.
Loading the Dishwasher en-us
Glass and silverware damage
Causes:
▯ Glass type.
▯ Type of dishwasher detergent.
▯ Water temperature of the wash cycle.
Recommendation:
▯ Use only glasses and porcelain which
the manufacturer designates as dishwasher-safe.
▯ Use a detergent which protects silverware.
▯ Use less intensive wash cycles and take glass and
silverware out of the dishwasher as soon as possible
after the wash cycle ends.
Loading the racks
For best dishwashing results, observe the following
when loading the dishwasher:
▯ Do not pre-wash items with loosely attached food
soil.
▯ Remove all food particles, bones, toothpicks and
excessive grease.
▯ Pre-treat items having burned-on, baked-on or
starchy soils.
▯ Load dishes in the dishwasher racks so the insides
of bowls, pots and pans are facing the spray arms.
▯ Avoid nesting and contact points between dishes.
▯ Separate items of dissimilar metals. Use care to not
block movement of the spray arms.
▯ Only wash household dishware and kitchenware
rated as dishwasher-safe.
Refer to the Dishware Materials section for more
information about dishware suitability.
NOTICE: To avoid dishwasher damage, do not load the dishwasher with paper products, plastic bags, packing materials or anything other than normal, dishwasher safe dishware and kitchenware.
Loading the upper rack
Ensure items do not protrude through the bottom of the
racks and block the spray arms.
Note: When pushing the upper rack 12 into the dishwasher, push it until it stops against the back of the tub so the upper rack spray arm 1: connects to the water supply at the back of the tub. Do not push racks in using the door.
Loading the lower rack
Place large items in the lower rack 1j. Load pots, pans
and bowls upside down. Do not block the vent hole with
tall baking sheets. Load these items on the right side of
the dishwasher.
19
en-us Loading the Dishwasher
Recommended loading pattern
Note: Folding the cup shelves down will allow the cups
to sit at an increased angle and reduce water pooling on
cup bottoms.
Lower rack - 12 place setting
Lower rack - 10 place setting
Upper rack - 10 place setting
Upper rack - 12 place setting
Third rack - 12 place setting
Third rack - 10 place setting
20
Loading the Dishwasher en-us
Loading the silverware basket
Place knives and sharp utensils with their handles up
and forks and spoons with their handles down. If large
or oddly-shaped items are loaded in the silverware
basket, be sure they do not nest together.
9 WARNING
Risk of injury!
The sharp points and edges of knives and other
sharp utensils can cause serious injury. Load
knives and other sharp utensils with edges down.
Do not allow children to handle or play near
knives and sharp utensils.
Suggested loading patterns
1 Salad fork
2 Teaspoon
3 Dinner fork
4 Knife
5 Tablespoon
6 Serving spoon
7 Serving fork
* optional feature which may or may not be included with
your dishwasher.
21
en-us Loading the Dishwasher
Rack accessories
Third rack *
The third rack 1* horizontally positions knives,
spatulas and other oversized tools for improved
cleaning and easier loading and unloading. Arrange
cutlery in third rack 1* as illustrated.
Depending on the features of your dishwasher, you can
fold down the side shelves to provide more room for
taller items of silverware. The front rows of prongs can
be folded down to provide room for wider handles.
Cup shelves *
The cup shelves and the space underneath can be used
for small cups and glasses or for larger items of
silverware, such as wooden spoons or serving spoons
or forks. If you do not require the cup shelf, it can be
folded up.
&/,&.
Adjust the height of the cup shelves as follows:
1. Position the cup shelf vertically and pull upwards.
2. Push cup shelf at a slight angle downwards to the
required height (1, 2, or 3).
&/,&.
3. Engage cup shelf.
Cup shelf “clicks” into position.
* optional feature which may or may not be included with
your dishwasher.
* optional feature which may or may not be included with
your dishwasher.
22
Loading the Dishwasher en-us
Flip tines *
Depending on the features of your dishwasher, the tines
can be folded down. This facilitates arrangement of
pots, bowls and glasses..
Fold down the flip tines as follows:
1. Pull flip tine gently forward and release it from the
notch (1).
2. Push the flip tine downward to the desired
position (2).
Extra tall item sprinkler *
Large trays or grills as well as large plates (gourmet
plates, pasta plates, dinner plates) can be cleaned with
this spray head.
Insert the spray head as follows:
1. Remove upper rack 12.
2. Insert spray head as illustrated and turn to the right.
Spray head is engaged.
To fold up, push flip tines into an upright position until
the holder engages in the notch.
* optional feature which may or may not be included with
your dishwasher.
Plastic item clips *
Light-weight plastic accessories (cups, lids, etc.) can be
held securely by the plastic item clips.
Press the plastic item clip against the rack as shown
until it clicks.
&/,&.
Notes
▯ Keep the vent hole on the tub’s left side clear by
placing tall items such as plastic cutting boards and
tall baking sheets on the lower rack’s right side or
center.
▯ Ensure that the dishwasher is always operated with
upper rack 12 or extra tall item sprinkler.
To ensure that the spray jet can reach all parts, arrange
the baking sheets as illustrated (max. 2 baking sheets
and 2 grills).
NOTICE: To avoid dishwasher damage, do not reinstall the upper rack 12 without removing the extra tall item sprinkler (B).
* optional feature which may or may not be included with
your dishwasher.
* optional feature which may or may not be included with
your dishwasher.
23
en-us Loading the Dishwasher
Gastronorm insert *
Gastr onorm insert
Helps you stack several Gastronorm drawers, trays
or similar large flat utensils at an angle in the lower
rack.
You can remove the insert if required.
Unloading the dishwasher
9 CAUTION!
Dishes can be very hot immediately after cycle
ends. Open the door slightly and allow dishes to
cool for a few minutes before unloading.
Note: Dishes are more likely to chip when unloading before cooling.
When unloading the dishwasher, to prevent water from
dripping onto dry dishes, unload the lower
rack 1j first. Next, unload the silverware
basket 1b followed by the upper rack 12, and then
the third rack (if equipped).
Adjusting the height of the rack *
Adj u s t i ng the hei ght of the rack
If required, the height of the upper rack 12 can be
adjusted to create more space for taller utensils either
in the upper or lower rack.
* optional feature which may or may not be included with
your dishwasher.
Appliance height 32 in (81.5 cm)
With silverware
Upper rack Lower rack
basket
Setting 1 max. ø 8.6 in (22 cm) 12.2 in (31 cm) Setting 2 max. ø 9.6 in (24.5 cm) 10.8 in (27.5 cm) Setting 3 max. ø 10.6 in (27 cm) 9.8 in (25 cm)
With third rack Upper rack Lower rack
Setting 1 max. ø 6.3 in (16 cm) 12.2 in (31 cm) Setting 2 max. ø 7 in (18.5 cm) 10.8 in (27.5 cm) Setting 3 max. ø 8.2 in (21 cm) 9.8 in (25 cm)
Appliance height 35 in (86.5 cm)
With silverware
Upper rack Lower rack
basket
Setting 1 max. ø 9.4 in (24 cm) 13.4 in (34 cm) Setting 2 max. ø 10.4 in (26.5 cm) 12 in (30.5 cm) Setting 3 max. ø 11.4 in (29 cm) 11 in (28 cm)
With third rack Upper rack Lower rack
Setting 1 max. ø 7 in (18 cm) 13.4 in (34 cm) Setting 2 max. ø 8 in (20.5 cm) 12 in (30.5 cm) Setting 3 max. ø 9 in (23 cm) 11 in (28 cm)
24
Loading the Dishwasher en-us
Arrange large plates up to a diameter of 12.2 in/13.4* in
(31/34* cm) in the lower basket 1j as illustrated.
* optional feature which may or may not be included with
your dishwasher.
Removing/Installing upper rack with
®
Rackmatic
Upper rack with upper and lower pairs of rollers
*
Upper rack with side levers
1. Pull out upper rack 12.
2. Hold the sides of the rack along the upper edge.
This prevents it from suddenly dropping.
3. To lower the upper rack; press in both levers on the
left and right on the outside of the rack. The upper
rack lowers.
1. Pull out upper rack 12.
2. Remove upper rack.
3. Re-attach upper rack to the upper (Setting 3) or
lower (Setting 1) rollers.
4. Push in upper rack.
4. To lift the upper rack; grip the sides of the upper rack
along the upper edge and lift.
5. Ensure that both sides of the upper rack are at the
same height.
6. Push in upper rack.
25
en-us Detergent
.
Detergent
Detergent
Use only detergent specifically designed for
dishwashers. For best results, use fresh powdered
dishwashing detergent or detergent tabs.
NOTICE: To avoid damage to dishwasher or dishware:
▯ Do not use hand dishwashing products in your
dishwasher.
▯ Do not use too much detergent if your water is soft.
Using too much detergent with soft water may cause
etching in glassware and fine china.
▯ To best protect glassware, use a wash cycle with low
temperatures or a specific glass-care cycle
(depending on the model) and use a detergent that
includes etch protection.
Note: If you do not know the hardness of your water supply, use 15 ml of detergent. Increase the amount if necessary to the least amount required to get your kitchenware clean.
3. Dosage: see manufacturer’s instructions on
the packaging. Use graduated detergent dispenser.
Usually 1¼ to 1½ tablespoons (20 ml–25 ml) are
adequate for normal soiling. If using tablets, one
tablet is adequate.
êWEVS
PO
êWEVS
PO
WEVS
PO
4. Close cover on the detergent dispenser.
Cover “clicks” into position.
&/,&.
Adding detergent
1. If the detergent dispenser 9* is still closed, actuate
locking bar 92 to open it.
2. Pour detergent into the dry detergent dispenser 9*
only. Do not overfill the detergent dispenser.
When using detergent tabs, lay them such that they
do not come in contact with the cover, insert a
detergent tab flat, not on its side.
Note:Do not place detergent tabs in the tab tray 1B. Place tabs or other detergent forms directly in the detergent dispenser 9*.
The detergent dispenser opens automatically at the
optimum time depending on the wash cycle. The
powder or liquid detergent is distributed in the
appliance and is dissolved, the detergent tab falls
into the detergent tab tray where it dissolves in
doses.
Tip: If the utensils are only lightly soiled, slightly less than the indicated amount of detergent is usually adequate.
Suitable detergents and care products can be
purchased online via our website or via customer
service (see back page).
26
Detergent en-us
Combination detergent
Apart from conventional single function detergents, a
number of products are offered with additional
functions. These products contain not only the
detergent but also rinse aid and salt replacement
substances (3in1) and, depending on the combination
(4in1, 5in1, ...), additional components such as glass
protection or stainless steel cleaner. Combination
detergents function only up to a specific degree of
hardness (usually 21°dH). Over this limit salt and rinseaid must be added.
As soon as combined detergents are used, the rinse
programme is adjusted automatically to ensure the best
possible rinsing and drying result.
Notes
▯ If you want to add more utensils after the wash cycle
has started, do not use the detergent tab tray 1B as
a handle for the upper rack. The detergent tab could
already be there and you will touch the partially
dissolved tab.
▯ Do not place small parts for washing in the detergent
tab tray 1B; this prevents the detergent tab from
dissolving evenly.
▯ You will obtain optimum rinsing and drying results
by using single function detergents and applying salt
and rinse aid separately.
▯ If wash cycles are short, detergent tabs may not have
full cleaning effect due to different dissolving
properties and there may even be undissolved
detergent residue. It is recommended to use washing
powder for these wash cycles.
▯ The dosing of a detergent tab is adequate for the
“Intensive” wash cycle (for some models). When
using washing powder, you can apply some of this
cleaning agent to the inside of the appliance’s door.
▯ Even if the rinse-aid and/or salt refill indicator is lit,
the rinse cycle will run correctly with combined
detergents.
▯ If using detergents in a water-soluble protective
cover: Take hold of the cover with dry hands only
and put the detergent into an absolutely dry
detergent dispenser only, otherwise the detergent
may stick.
▯ If you switch from combined detergents to single
function detergents, ensure that the water softening
system and amount of rinse aid have been set to
the correct value.
▯ Biological/eco detergents: Detergent products
identified as “Bio” or “Eco” (to protect the
environment) usually use lower quantities of active
agents or completely dispense with certain
substances. The cleaning effect of such products
may occasionally be restricted.
27
en-us Dishwasher Cycles
/
Dishwasher Cycles
Dishwasher Cycles
Note: In order to save energy, it is recommended to set the Auto Power Off feature to “After one minute”.
Wash cycle Recommended use Possible wash cycle option
AUTO
150 - 160° F
This cycle cleans items having baked-on or hard dried-on
food soils. These items may require soaking or hand
all
scouring.
AUTO Wash
130 - 150° F
This cycle is appropriate for mixed loads.
It is optimised according to the soiling with the aid of
all
sensors.
Regular
(see note at bottom of
table)
Recommended for daily, regular or typical use to
completely wash a full load of normally soiled dishes.
all Note:In order to obtain
optimal performance with
minimum energy
consumption, it is
recommended to disable all
available options and
settings, except Auto Power
Off
Quick Wash
Glass Care
Cleans lightly soiled dishes with easy to remove food
soils.
A cycle for lightly soiled dishes which is ideal for
temperature sensitive dishes or silverware. In this cycle
Extra Dry
all
the temperature is reduced to help prevent dishes from
becoming damaged. It is especially helpful to reduce a
cloudy or etched appearance on glasses.
Note:Some glasses are more prone to etching due to the glass manufacturing process.
Use this cycle if you need to pre-rinse dishes to avoid
Rinse
odors. Place unrinsed dishes inside the dishwasher and
select the Rinse cycle. Uses less water than hand rinsing
and very low energy.
Note: The Energy Guide label was based on the Normal or Regular soil sensing cycle as follows: The unit was tested without any rinse aid (liquid) in the rinse aid dispenser 9". A single dose of detergent was inserted into the detergent dispenser 9*, with no detergent being used in the prewash. The unit was not subjected to truncated testing per the definitions in the test procedure. We recommend that dish loads such as the one in the energy certification test have the rack position set in the highest position.
28
Dishwasher Cycle Options en-us
0
Dishwasher Cycle Options
Dishwasher Cycle Opti ons
Intensive Zone Ï
Intensi ve Zone
Perfect for a mixed load. You can wash very soiled pots
and pans in the lower rack together with normally soiled
utensils in the upper rack. The spray pressure in the
lower rack is intensified, the rinsing temperature is
increased slightly.
Cycle time
AUTO Wash 130-150°F
105 - 129 110 - 135 130 - 135 30 70 9
AUTO* 150-160°F
Regular Quick Wash Glass Care Rinse
in min.
Water cons. in
L (gal)
Wash temp. in
°F (°C)
Rinse temp. in
°F (°C)
13.1-24.5
(3.5-6.5)
127-150
(53-66)
18.6-24.2
(4.9-6.4)
150-160
(66-71)
8.3-20.6
(2.2-5.4)
113-131
(45-55)
158 (70) 162 (72) 144-156
(62-69)
Intensive Zone
Cycle time
120-145 125-145 145-150 N/A 85 N/A
in min.
Water cons. in
L (gal)
Rinse temp. in
°F (°C)
13.1-24.5
(3.5-6.5)
18.6-24.2
(4.9-6.4)
8.3-20.6
(2.2-5.4)
158 (70) 162 (72) 144-156
(62-69)
Power
Cycle time
75-90 95-110 95-105 N/A 60 N/A
in min.
Water cons. in
L (gal)
Rinse temp. in
16.1-20.0
(4.3-5.3)
16.3-20.5
(4.3-5.5)
16.6-21.1
(4.4-5.6)
162 (72) 162 (72) 156 (69) N/A 140 (60) N/A
°F (°C)
*sanitize
Power ¥
Power
The cycle time is reduced significantly in the Power
option. The energy consumption is increased by up to
30% due to more intensive heating.
Wash Cycle Information
To save energy, this dishwasher has EcoSense where
the sensors in the dishwasher automatically adjust the
cycle length, temperature and water changes based on
the amount of food soil and the incoming water
temperature. The “Smart Control” makes decisions that
can cause the cycle time and water usage to adjust
intermittently. Wash cycle times are based on 120°F
(49° C) water supply. If your household water supply is
different than 120°F (49° C), your dishwasher’s cycle
times may be impacted.
10.5 (2.8) 13 (3.4) 4.1 (1.1)
113 (45) 122 (50) incoming
122 (50) 140 (60) incoming
N/A 13 (3.4) N/A
N/A 140 (60) N/A
N/A 13.3 (3.5) N/A
Note: Only sanitizing cycles have been designed to meet the requirements of Section 6 of the NSF/ANSI Standard for Residential Equipment for soil removal and sanitization efficacy. There is no intention, either directly or indirectly, to imply that all cycles have passed sanitization performance tests.
29
en-us Operating the Dishwasher
1
Operating the Dishwasher
Operating the Dishwasher
Note: With hidden controls, the door must be opened before changing settings and closed after changing settings.
9 WARNING
Risk of injury!
To avoid risk of injury, always use caution when
opening the door during or following a wash cycle
as hot water or steam may escape. Do not fully
open the door until water noises have stopped
and steam has subsided.
To reduce risk of injury, do not allow children to
play in or on the dishwasher.
When children become old enough to operate the
appliance, it is the responsibility of the parents/
legal guardians to ensure the children are
instructed in safe practices by qualified persons.
Operating the touch buttons
Buttons are sensitive and should be touched gently.
Avoid any grease or food particles resting on the
buttons as they could activate the dishwasher.
Wiping and cleaning can also activate the dishwasher.
For best results, use bare, clean hands when touching
the buttons.
To clean the touch buttons wipe them with a dry or
slightly damp cloth.
Changing the settings
The dishwasher has been preset with certain settings
for your convenience. You can change these factory
settings.
Change the setting as follows:
pen the door.
1. O
2. Switch on ON/OFF button (.
3. Press Info button ( 8 for 3 seconds until the
following text is indicated in the digital display @:
Protection against unintentional operation
Your dishwasher is equipped with a function that helps
to prevent unintentional operation (e.g. by children).
After starting the dishwasher, the dishwasher door has
to be closed within 4 seconds, otherwise the operation
will be paused. There will be a signal on the control
panel advising you to press the Start button again and
close the door.
This function will be activated when:
▯ pressing Start to begin a wash cycle
▯ setting Delay time and pressing Start
▯ opening the door while Delay time is active
▯ opening the door during a wash cycle.
Note: This function cannot be deactivated.
Scroll with < >
Set with - +
Leave with t 3 sec.
4. Keep pressing button >)* until the required setting
is indicated in the digital display @.
5. Make the selection with setting buttons + -X.
6. Press and hold the Info button (8 for 3 seconds.
The chosen setting has now been stored.
Tip: If you change several settings, first mak
nges in succession. Now press the Info button ( 8
cha
for
3 seconds. This saves all set values in the appliance.
e all
30
Loading...