Funkwerk elmeg CS410, elmeg CS410-U, elmeg CS400xt, elmeg IP-S400 Operating Instructions Manual

Download

Operating instructions

elmeg CS410 / CS410-U / CS400xt / IP-S400

English

Declaration of conformity and CE mark

This device meets the requirements of the following EC directive R&TTE 1999/5/EG:

»Directive 1999/5/EC of theEuropean Parliament and ofthe Council of9 March 1999 on radio equipment and telecommunications terminal equipment and the mutual recognition of their conformity«.

You can also request this EC declaration of conformity at the following Internet URL: http://www.funkwerk-ec.com.

The waste containersymbol withthe "X" throughit onthe device indicatesthat the devicemustbedisposed ofseparatelyfromnormal domesticwasteatan ap propriate waste disposal facility at the end of its useful service life.

Reprintingofthisdocument,evenexcerpts,ispermittedonlywiththeexpressconsentofthepublisher and with precise source information, regardless of the media used (mechanical or electronic).

Function descriptionsincluded in thisdocumentation whichrefer tosoftware products ofother manufacturers are basedon the softwareused and valid at the datethe documentation was prepared or published. The product and company names used in this documentation may be protected by trademarks.

Contents

Description and installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1

CS400 / CS400xt . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1

Configuring emergency operation (PtMP and PtP connections) . . . . . . . . . . . . . . . . . . . . . . 2

Configuring emergency operation at a point-to-point (PtP) connection . . . . . . . . . . . . . . . . . . 2

Making calls during emergency operation at a point-to-multipoint connection . . . . . . . . . . . . . 2

Making calls at emergency power supply mode on a point-to-point connection . . . . . . . . . . . . . 2

CS410. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2

CS410-U . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2

elmeg IP-S400. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2

Setting up/ Configuring the system telephone . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2

System-telephone extension modules. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3

Up0/S0-module (CS410 only) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3

Answering machine module (only CS410, CS410-U) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3

Additional »T400« keyboard . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3

Additional »T400/2« keyboard. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3

Safety notes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3

Plug-in power supply . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4

Elektrostatic charges (protection against electrostatic charges) . . . . . . . . . . . . . . . . . . . . . . . 4

Unpacking and placing the telephone. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4

Unpacking . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4

Placing the telephone . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4

Cleaning the telephone . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4

Connecting the telephone (connecting and handset cords) . . . . . . . . . . . . . . . . . . . . . . . . .5

Connecting the handset connecting cord. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5

Connecting the connecting cord. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5

Important notes for connecting the telephone to the Up0 . . . . . . . . . . . . . . . . . . . . . . . . . . 5

Connecting and configuring a headset (not included in the scope of supply) . . . . . . . . . . . . . . . 6

Connecting a headset . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6

Further settings when using a headset . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7

Connecting the telephone to a PC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7

Connecting the PC connection cable (USB) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7

CS 410, CS 410-U connecting the audio cable (Audio in / Audio Out) . . . . . . . . . . . . . . . . . . . 8

IP-S400 Audio in / Audio out . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8

elmeg IP-S400 at the Ethernet-port . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8

PIN assignment for PoE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9

Connecting to and operating the system telephone at the pabx system

(basic function including DHCP) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9

Changing the label . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10

Pictographs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11

Setting the display language . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11

Telephone display and buttons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12

Telephone display . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13

Special feature for displaying lists in the display . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14

Special feature for changing existing entries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14

Key assignments for entering texts. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15

Input mode for entering letters. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15

Call signaling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15

Contents

Function keys and LEDs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16

LED call signaling and answering machine. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16

Acknowledegement signals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16

Positive acknowledgement signal (1 long tone): . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16

Negative acknowledgement signal (3 short beeps): . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16

Displays for programmed features. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16

Displays ........................................... 17

Configured function . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17

Making Calls . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18

Starting a call . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18

Dial number - no correction possible . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18

Dial call number - correction possible. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18

Other options for dialing without lifting the handset . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18

Dialing from the pabx telephone directory. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19

Dialing from the telephone directory . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19

Dialing from the VIP memory . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19

Direct dial-in using function keys . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19

from Dialing from the caller/memo list . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19

Accepting / rejecting a call. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20

Call Deflection. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20

No number transmission (anonymous call) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20

Starting a call with a fixed extension number (MSN) . . . . . . . . . . . . . . . . . . . . . . . . . . 21

Redialing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .21

Extended last number redial . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21

Deleting a telephone number from extended redialing or save as a memo . . . . . . . . . . . . . . . . 22

Importing numbers from extended redialing into the telephone directory. . . . . . . . . . . . . . . . 22

Automatic redialing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22

Suspending automatic redialing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23

Deactivating automatic redialing. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23

Microphone activation/deactivation, open listening and hands-free calling . . . . . . . . . . . . 23

Mute on/off . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23

Speaker function . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23

Hands Free Calling. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24

Headset use . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24

Activating and deactivating the headset. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24

Activating and deactivating open listening while using the headset. . . . . . . . . . . . . . . . . . . . 24

Announcement . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24

Intercom . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25

Automatic completion of call . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26

Automatical recall to busy subscriber (CCBS) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26

Automatic completion of calls on no reply (CCNR) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26

Programming completion of call to busy subscriber. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26

Viewing and clearing call-back calls . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27

Parking a call (not with IP-S400). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27

Park . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27

Unparking. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27

Tracing (MCID)(only via ISDN cord) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27

Malicious call identification during ongoing call. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28

After the caller has hung up the handset . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28

Keypad and tone frequency dialing (DTMF dialing) . . . . . . . . . . . . . . . . . . . . . . . . . . 28

Contents

Keypad. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28

Tone dialing (dtmf dialing) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28

Conducting calls with several subscribers . . . . . . . . . . . . . . . . . . . . . 29

Call waiting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29

Inquiry Call . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29

Transferring a call to a busy subscriber . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29

Call switching . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30

Broker’s call . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30

Three-party conference . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30

Telephone operation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32

Telephone directory . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32

Settings for telephone book entries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32

Name and number . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32

Outgoing number (MSN assignment) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32

Special dial tone . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32

Infotext . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32

Add an entry to the telephone directory. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33

Editing phone directory entries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33

Deleting a phone directory entry. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33

Programming special dial tones (VIP-tones) for telephone directory entries . . . . . . . . . . . . . . 34

Programming an info text for a telephone book entry. . . . . . . . . . . . . . . . . . . . . . . . . . . . 34

VIP-Memory. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34

Programming VIP entries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34

Editing VIP entries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35

Caller- and Memo list . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35

Caller list . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36

Memo list . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36

SMS / UUS1 messages . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36

UUS1 Inhibiting filter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36

Viewing the caller list . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37

Further information about a call / memo . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37

Further information about a text message (SMS / UUS1). . . . . . . . . . . . . . . . . . . . . . . . . .38

Deleting the caller / memo list . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39

Deleting an entry. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39

Deleting all calls . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39

Entering the number of the caller in the phone book of the phone . . . . . . . . . . . . . . . . . . . . 39

Entering a memo. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39

The following example describes how to add a new number as a memo. . . . . . . . . . . . . . . . . 40

SMS and UUS1 text messages . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40

SMS Text Messages (subject to terms of network provider) . . . . . . . . . . . . . . . . . . . . . . . . 40

UUS1 text messages . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41

Creating and sending text messages Creating and sending text messages . . . . . . . . . . . . . . . . 41

Example: Creating a UUS1 text message . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41

Important notes for entering numbers with SMS transmission . . . . . . . . . . . . . . . . . . . . . . 42

Sending an interlaced SMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42

Viewing newly received text messages . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42

Viewing received or sent text messages . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42

Example: Reading a received UUS1 message . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43

Permanently stored text messages (UUS1 only) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43

Automatic sending of text messages (UUS1 only) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44

Configuring the text message reception mode (UUS1 only) . . . . . . . . . . . . . . . . . . . . . . . . 44

III

Contents

Error when sending or receiving an SMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45

Error while sending an SMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45

Error while receiving an SMS. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45

Silent signalling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .45

Monitoring costs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46

Procedures for charge rate transmission . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46

Viewing and deleting costs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46

Viewing/deleting costs for the last call . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46

Viewing and deleting total costs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47

Viewing/deleting costs for specific extension numbers (MSN). . . . . . . . . . . . . . . . . . . . . . . 47

Setting the tariff factor and the currency . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47

Programming a charge limit for an extension number . . . . . . . . . . . . . . . . . . . . . . . . . 48

Enabling or inhibiting an extension number (MSN) for outgoing calls . . . . . . . . . . . . . . . 48

Communication and charge displays . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49

The following displays are possible during a call: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49

Displaying information during a call . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50

Programming calling line identification mode (CLIP/CLIR/COLP/COLR). . . . . . . . . . . . . . . . 50

System telephony. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52

Function keys . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52

Function key examples . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52

Direct dialing buttons (see page 19) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52

DTMF/ keypad sequences (see page 28). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52

Defining the MSN extension number for the next call (MSN assignment) . . . . . . . . . . . . . . . . 52

Line keys . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52

Trunk group buttons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52

Extension keys . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52

Connection keys . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53

»System-parked inquiry« button . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53

Team keys. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53

Team log-on/off . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53

Day/ Night modes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54

Announcement (see page 24). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54

Message enable on/off . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54

Intercom (see page 25) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54

Intercom enable on/off . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54

Boss/Sec.-function . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54

Xfer secretary . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54

Call filter. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54

Call rerouting. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54

Direct dial-in . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54

Headset on/off . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54

Auto-Answer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54

Extension key for an answering machine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55

Voice Mail-Button . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55

User on/off button (sertaste ein/aus (programming the system telephone’s MSN extension number) 55

Status info button . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55

Macro functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55

LED functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56

Programming a function key . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56

Using the function key. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57

Important notes for LED functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57

System menu at a pabx with system telephony . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57

Contents

Accessing the system menu for PABX systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57

Configuring and setting up the system telephone . . . . . . . . . . . . . . . . . 59

Extended configuration . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59

Acoustic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60

headset . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60

Speaker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60

Call waiting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61

Acknowledgement signals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61

Idle. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62

Handset . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62

Notice tone (announcement and Intercom) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63

Announcement. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63

Intercom . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63

Answering machine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63

Date . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64

Audio-Out. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64

Listening to Audio-In over the speaker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64

Settings. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65

Direct call . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65

Call rerouting (call forwarding) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 66

Special features for the Swiss version . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 67

Call waiting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68

Display contrast . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69

Appointment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69

Deactivating an appointment reminder. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70

Auto-Answer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70

Headset . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70

Operation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71

Setting the time. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71

Call filter. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 72

Call filter operating modes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 72

Programming filter numbers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 72

The following example describes how to enter a new filter number. . . . . . . . . . . . . . . . . . . . 72

Configuration. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74

inhibit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74

PIN. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74

Menu. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75

Outgoing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75

List . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76

Display . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76

Call number. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76

Language . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77

Conversation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77

Call-Parking (default setting). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78

Connection to a pabx . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78

MSN (extension numbers) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79

Entering a name for an extension number . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81

Programming a specific PIN for an extension number (MSN). . . . . . . . . . . . . . . . . . . . . . . 82

Setting up the IP-S400 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 82

Log-on. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83

Entering the IPS Log-in PIN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83

Entering the »Sys-Server Log-In PIN for the IPS« . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83

Contents

Configuring the IP-S400 without DHCP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 84

Programming numbers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87

Programming function keys . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87

Function keys and further entries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87

function . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87

Displays . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87

Further entries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87

Commands and keys for macro programming . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88

The following commands are available for macro programming: . . . . . . . . . . . . . . . . . . . . . 88

Key assignments for macro programming . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 89

Macro programming examples: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90

Service . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91

Name . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91

SMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91

Version . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 92

Data . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 92

Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93

Initiating download of new firmware on the phone:. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94

Telephone BIOS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95

The following functions are available in the telephone’s BIOS . . . . . . . . . . . . . . . . . . . . . . .95

Downloading new firmware via the PC port . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95

Downloading new firmware via the ISDN connection. . . . . . . . . . . . . . . . . . . . . . . . . . . . 95

Country . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95

Country-specific settings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95

Telephone and PC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97

CTI / TAPI using the phone’s USB port . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97

CAPI using the telephone’s USB port . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97

Fax and data services (not included in the delivery). . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97

Internet access . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97

Audio applications using the phone’s audio jacks . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98

Contents of the WIN-Tools CD-ROM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98

Programs for telephone configuration (WIN-Tools) . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98

Application programs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98

Drivers. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98

Important note for installation of the CAPI drivers:. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 99

Installing the programs from CD-ROM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 99

PC requirements:. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 99

Installation sequence . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 99

Default telephone settings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104

Menu of the Telefone . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106

Menu »Configuration«. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106

Menu»Acoustic« . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107

Menu »Settings« . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108

Menu »Program nos« . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109

Technical specifications . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110

ISDN port (CS410, CS400). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110

Up0-Connection (CS410-U). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110

USB port . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110

Audio connections . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110

Ethernet-port . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110

Contents

Index . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 113

Brief description of functions. . . . . . . . . . . . . . . . . . . . . . . . . . . . 121

VII

Description and installation

Youcan connectthe systemtelephoneat theinternalS0, Up0or Ethernetconnectionof a pabx system. The telephone provides system features when connected to certain elmeg PABX systems. For example:

Dialingfrom thepabx telephonedirectory

•

Sendingand receivingSMS messages

•

Messagingandintercomcallswithothersystemtelephonesconnectedtothepabx.

•

Function keys for controlling special PABX features (switching call modes, team log-in/off, line

•

buttons,extensionbuttons). The statusof theprogrammed features can bedisplayed by meansof LEDsassigned tothe specific functionkeys.

Accessingthe PABXsystem menu. Thismenuprovides furtherpabxfeatures.

•

The internal connection of the PABX systems automatically interfaceswith the system telephone. Please refer to the operating instructions of your PABX to determine whether these typical system features are provided with the various system telephones.

CS400 / CS400xt

Thissystem telephoneisdelivered withakey extensionmodule(T400/2), providingyouwith 10additional, freely configurable keys.

Itis designedforconnectiontoan internalS0port (4-wirecable)of aPABXsystem. Thesystem telephoneis not equippedwith a USB orserial port forconfiguration orother uses. This phone mustbe configured via theinternal ISDNport usingtheWinTools ProfessionalConfigurator. There arealsono»Audio functions« implementedand youcan notuse theAnswering machineor Up0modules orfunctions. None ofthe functions for this module are shown in the display, nor can they be used.

Thistelephone isequippedwith thefunction»Emergencyoperation«.»Off« = Emergency operation off, »On« = Emergency operation On. meaning it

OFF ON

Selection of a call number from the telephone directory or the speed dial memory after liftingthe

•

handset. Displayof callduration andcosts.

•

Mute.

•

Terminatecall.

•

can be operated at NT via the PABX system on a loss of 230 V~ power. If more than one telephone is connected to the ISDN system, the emergency operation functionmay only beconfigured onone of theISDN systemtele phones. All callsare signaled at thisphone. The volumeof the ringingtone isset tolow. Inaddition tomaking normalcalls, thefollowingfunctions are also available:

The phone number(MSN) that the network serviceprovider assigned to you as thefirst (master) number willbe transmittedto externalsubscribers. Chargebilling iseffected forthis. Observe theinformation con cerning emergency operation in the PABX system. Ongoingconnections are interrupted in the event of a power failure.

Refer tothe operatingmanual of your PABXsystem to see ifyour system supports emergency operation.

Description and installation

Configuring emergency operation (PtMP and PtP connections)

Emergencyoperation isnotconfiguredasa factorydefaultfeature. Aslideswitch islocatedonthebottom of the system telephone that can be used for configuring emergency operation.

To configurethe emergencyoperation feature, slidethe switch on theleft side onthe bottom of thephone down. To de-activate emergency operation, slide the switch back to the top position.

Attention: Before you move the emergency operation switch unplug the ISDN connector for the system telephone. Use a non-metallic tool to move the switch.

Configuring emergency operation at a point-to-point (PtP) connection

Ifyou wishtoalso useyoursystem telephoneforemergency operationata PtPconnectionyou mustalsoac tivatethis featureusingthe PCconfigurationforyoursystem telephone. Youcan usetheconfiguration pro gram to set emergency operation at a PtP connection.

Making calls during emergency operation at a point-to-multipoint connection

The systemtelephone begins emergencyoperation whenpower supplyfor the PABXsystem and theNT is lost.Emergency operation,followedbyatelephone symbolisthenshown inthesystem telephonedisplay.

Ifthe 230VACpower supplyisrestoredduring anongoingcall, allnormal,configuredfunctions areavaila ble againonly afteryou hangup the handset. If the230V~ power supplyis restored whenthe handsetis in the cradle,the emergencyoperation displayis replacedby thenormal displaywhenthe handsetis lifted,or on the next call.

Making calls at emergency power supply mode on a point-to-point connection

During emergency power supply mode at a point-to-point connection, you will see the normaloperation displays.

CS410

Thissystem telephoneisdesignedfor connectionto aninternal S0-port(4 wires)of an pabxsystem. If you wish to connect the telephoneto an internal Up0-port, be sure to install the internal Up0/S0-module into the telephone or use the external Up0/S0-converter.

CS410-U

Thissystem telephoneisdesignedfor connectionto aninternal Up0-port(2 wires)of an pabxsystem. The internal Up0/S0-module or the external Up0/S0-converter is then no longer required.

elmeg IP-S400

Connectthis systemtelephonetothecorresponding LANport(or network)ofthePABX systemusinga Cat. 5cable. Thesystemtelephoneisequipped withaPC outputthatcan beusedto connectotherIPterminal de vices.

Setting up/ Configuring the system telephone

On the system telephoneitself you can only carry out alimited configuration of thesupported features. A fullconfiguration isonlypossible withanelmeg telephonesystemusingthe professionalWINtool configu rator via the corresponding system telephone interface.

System-telephone extension modules

Up0/S0-module (CS410 only)

Install theUp0/S0-module into your telephoneif you wishto connect thephone to a Up0-portof a

•

pabx.TheexternalUp0/S0-converter isthennolongerrequired.

Answering machine module (only CS410, CS410-U)

Thismoduleprovidesyour telephonewithamulti-functiondigitalansweringmachine.

•

FOREXAMPLE.: Separateprogramming foreachMSN extensionnumber, time-controlfeaturefor voice announcement related to specific MSN extension numbers, automatic notification with newlyrecordedcalls, recordingof dictations,logging ofcalls, remotepollingprotected byPIN. Aspecialkey andLED areprovided foroperation ofthe answeringmachine.

Additional »T400« keyboard

Thisadditional keypadhas 20buttons withan insetLED, whichcan beused ontwo levelsas functi

•

onbuttons. The LEDisassigned tothe firstlevel. Another twoLEDs areprovidedfor indicatingad ditionalinformation. Up to three additional keypads can be connected (cascaded) to your telephone. A plug-in power supply isrequired if youuse more thanone additional keypad. Use onlythe approved T400power supplyunits availableasaccessory /serialnumber220872.5or T400-UK/serial number220873.3.

Description and installation

Additional »T400/2« keyboard

Thisadditional keypadhas 10buttons withan insetLED, whichcan beused ontwo levelsas functi-

•

onbuttons. The LEDisassigned tothe firstlevel. Another twoLEDs areprovidedfor indicatingadditionalinformation.

Safety notes

Mind the storage and operation temperatures for the device listed in the technical specifications.

•

Onlyconnectthe devicewhen thepermissible ambientoperating temperaturehas beenreached. Please note that condensation on or in the unit may occur when moving from cold to warm sur-

•

roundings. Only removethe telephone from the packagewhen the permissibleambient operating temperaturehasbeenreached.

Youshould notmake callsor connector disconnectany linesduring thunderstorms.

•

Onlyattachtheconnectingcords at theconnectionsprovided.

•

Make surephonecablesare installedina safemannerto preventtripping.

•

Avoidthefollowing:

•

Directsunlight Sourcesof heat(for exampleradiators) Electronicdevices(for examplestereocomponents,officeequipmentormicrowavedevices) Ingressofmoistureorliquids Aggressivefluids orvapors Dustyenvironment

Donotusetheunitinexcessivelyhumid roomsor hazardouslocations.

•

Onlyopenthose sectionsofthedevicespecifiedinthe assembly/ operatinginstructions.

•

Donottouchplugconnectorswithpointed, metal,or moistobjects.

•

If you do not permanently mount the device or any accessories, be sure to place it/them on a

•

non-slipsurface. Whenrequired, cleantheunit witha slightlymoistened cloth.

•

Onlyuseapproved accessories.

•

Description and installation

Onlyterminals withSELVand/or whichcomply withETS300047 maybeconnectedto theunit.This

• regulationisfulfilledwhenapproved terminaldevicesareusedas intended.

Plug-in power supply

Useonlyapproved powerplug-inunits(DSA-0101F-05 UPor L15D52 ABDDLAWO).

• Donotusepowerplug-inunitswithvisibledefects ordamage(fissures,cracks, etc.)

•

Elektrostatic charges (protection against electrostatic charges)

The telephone issupplied with enhanced ESD protection againstthe effects of electrostaticdischarge that exceeds theprotection levelcited in theapproval specification. Elevated ESD levelsshould neverthelessbe avoided to thegreatest possible extent. In some cases, electrostatic dischargelevels can farexceed the ap proval limitsor theresistance levelsalready implementedin yourtelephones. Eliminate thecauses orcon ditions that promote theseelevated ESD levels, such as insufficienthumidity or carpeting. The telephone manufacturer does not assume any liability for damage caused under such circumstances.

Unpacking and placing the telephone

Unpacking

Systemtelephone

•

Handsetwithhandsetconnectingcord

•

2feet

•

1ISDN connectingcord, approx.6 m(not withIP-S400)

•

Cat.5 connectingcord, approx.2 m(only withIP-S400)

•

PC-Connectioncable/USBcord ,approx. 3m (notwith CS400and IP-S400)

•

PC-audio cable,3.5 mmstereo jack,approx. 2,5m long(not with CS400 andIP-S400)

•

Adapter cordfor headsetwith a4 pinconnecting cord(8pin/4 pin)

•

Cableholder(self-adhesiveafterremovingthefilm) (notwith CS400)

•

Operatinginstructions andlabelsforfunctionkeys

•

Supplementwithtelephone safetyinstructions WIN-ToolsCD-ROM with:

•

ProfessionalConfigurator,telephonedirectory-, download-and soundmanager, TAPI-,USB-,CAPI- andNDISWAN driver,Adobe AcrobatReader, Operatinginstructions andAdobeAcrobatfilefortheprintingofindividuallabels

Placing the telephone

Beforeinstallingthetelephoneyou mustmount therear feetfor thetelephone atthe positions(6) shownin figure 1. Pleasenote thatthefeetofyour telephonemayleave marksonsensitivesurfaces,such asfurniture. The ma nufacturer of the telephone is not liable for any such damage. Therefore, use appropriate non-skidding pads under the phone.

Cleaning the telephone

The ISDN system telephone has been manufactured for normal, everyday use. When required, clean the ISDN systemtelephone witha slightly moistenedcloth, orwith ananti-static cloth. Never use a solventto cleanthe phone!Neveruseadry cloth;electrostaticcharges coulddamagethe electronicsinthe system. Itis essential that no liquids penetrate into the inside of the ISDN system telephone, as this could destroy the phone.

Description and installation

Connecting the telephone (connecting and handset cords)

Pleaseconnect theISDNcableand thehandsetcable. Otherwiseyouwillnot beableto operatethephone.

Figure 1

Connecting the handset connecting cord

Connectthe handsetcord(1) asshowninfigure 1. Laythe handsetcordin thecordgroove (4)andlockitbelow the two cord retainers (5).

Connecting the connecting cord Connection to the S0 (CS410, CS400)

Connect theISDN cord (2) asshown infigure 1 (S0-connector). Ensure that thelonger ISDN connectoris pluggedinto theISDNjack andtheshorter ISDNconnectorinto theISDNsocket onthetelephone. Thenlay the ISDN cord in the cord groove (4) and lock it below the two cord retainers (5).

Connection to the Up0 (CS400,CS410 with Up410/S0-module or CS0-U)

Connect the ISDN cable (1) as shown in figure 2 (Up0-socket). Ensure that the longer ISDN connector is pluggedinto theISDNjack andtheshorter ISDNconnectorinto theISDNsocket onthetelephone. Thenlay the ISDN cord in the cord groove (2) and lock it below the two cord retainers (3).

CS410 telephones equippedwith a Up0/S0 moduleor CS410-U phones may not beconnected through the S0-socket to an ISDN connection (e.g. internal ISDN port of the PABX).

Important notes for connecting the telephone to the Up0

Youcan connectafurther ISDNdevicewith anS0-port (forexamplean ISDNcardor aanothertele

•

phone) atthe S0jack of thetelephone. For eachadditional ISDN devicethis connection provides a powerof1 watt.

Description and installation

Figure 2

Connecting and configuring a headset (not included in the scope of supply)

Youcan connecta headsettoyourtelephone. Ask yourdealer whichheadsetmodels canbe usedorretrieve the required information from the Internet.

The telephoneis equippedwith an 8-pinsocket for connectinga headset. Headsets witha DSHG-interface (e.g. cordlessDECT-headsets)can beconnected tothe telephonerightaway. Specialaccessories arenot required for this. For the connection of standard headsets (connection cable of 4 pins, e.g. U10PS) use the supplied adapter cord.

You canconnect / installthe optional AnsweringMachine moduleand a headsetwith a DSHG port simultaneously to/in a system.

Connecting a headset

Connect the headsetas shown in figure 1 on page 5to the telephone’s dedicated headset socket. Then lay the headset cord (3) in the cord groove (4) and lock it below the cord retainers (5). If theheadset corddoes notfit inthe cordguide, attachthe self-adhesivecord holder suppliedwith thesys tem to the bottom of your telephone (7). Then, route the headset cord under the cord holder.

Assignment of the headset jack pins (CS410 / CS410-U)

8 - transmitter 7 - V+ (3.3V) 6 - Microphone - (Ground) 5 - Handset (3.3 V switchable via resistor) 4 - Handset (ground) 3 - Microphone + 2 - Ground 1 - receiver

Figure 3

Assignment of the headset jack pins (CS400 / CS400 /CS400xt)

4 - Microphone - (Ground)

4 2

3 - Handset 2 - Handset (ground) 1 - Microphone +

Description and installation

Figure 4

Further settings when using a headset

You canuse thehandset orthe headsetfor makingcalls. With headsetoperation, thefollowing settingsare required or possible:

Whenconfiguring yourtelephone,program oneofthe functionkeysfor headsetoperation(headset

•

button,seepage54). You can use theheadset connected to your system automat icallyfor certain actions on the phone

•

(seepage70). Ifa specialsupport featureisstoredin yourtelephone fortheheadset yourare using,setyour phone

•

forthat headsetmodel (seepage59). Forexample, theLED inthemicrophone extensionfor»Firefly F142N« fromPlantronicscan beac tivated bythetelephone.

If youwould liketo usethe auto-answerfeature withyour headset, set thetime afterwhich acall is

•

answered(see page70).Whenconfiguringyour telephone,youshould programafunctionkeyto be usedfor activatingor deactivatingthe auto-answerfeature.

If youhave configuredyour phone for automaticheadset use, you canpoll the answeringmachine

•

usingthe headset.

Connecting the telephone to a PC

Connecting the PC connection cable (USB)

Use theUSB cordsupplied withthe systemto connectthe telephoneto thePC, orto thehub. If youuse adifferentUSB cord,ensurethatthe distancebetweenthe telephoneandthe PC,orbet weenthe telephoneandthe hub,doesnot exceedfivemeters,depending onthetype ofcord you are using.

Description and installation

Connectthe USBcord (4)as shownin figure5(PC-socket). PlugtheUSB connector(type A)into thecorre spondingsocket ofyourPC andtheUSB connector(typeB) intotheUSB socketonthe backofthe telephone (1). The telephoneis automaticallydetected bythe PC,provided that both devices(telephone and PC) are switched on.

Installat ionof a devicedriver is startedautomatically the firsttime you connectthe telephone to thePC. Insert theWIN-Tools CD-ROMsupplied with thetelephone andfollow the instruc tions displayed on the screen.

You willneed a hub(USB distributor)if you planto useseveral USB terminaldevices atyour PC. Connect thehubto theUSBport ofthe PC.You canthen connectother USBterminal devices,including thetelepho ne to the hub.

CS 410, CS 410-U connecting the audio cable (Audio in / Audio Out)

Thetelephone isequipped withan input(2)andanoutput (3)for audiosignals. Both theseports havea 3.5 mmstereo socket.Whenusing theoptional answeringmachine module,you canconnect thetelephone via these ports to the PC sound card in order to upload announcements into the phone or save recorded messages on the PC.

Youcan alsouse specifictelephonefeatures withthe Audio-Outoutput(see page64). Connectthespeakers (5) with a 3. 5 mm stereo jack to the telephone’s Audio-Out (3) output, as shown in figure 5.

IP-S400 Audio in / Audio out

The telephone isequipped with an input (2) andan output (3) for audio signals.These ports are provided for headsets(6). Thejacks are linked tothe correspondingports for the headsetjacks on the bottomof the telephones.

Figure 5

elmeg IP-S400 at the Ethernet-port

The IP-S400system phonecan bepowered throughthe Ethernetport as defined inIEEE Std 802.3af-2003 (PoE),with powerbeingsuppliedvia Ethernetfrom thehubor switch.At theport, »AlternativeA«and »Al

Description and installation

ternative B«, as defined by IEEE Std 802.3af-2003, and »Power classification 1« (up to 4 W) is supported. The PoE port is not polarity sensitive.

PIN assignment for PoE

PIN 1 = Transmit Data + / PIN 2 = Transmit Data PIN 3 = Receive Data + / PIN 6 = Receive Data PIN 4 / PIN 5 connected = power supply PIN 7 / PIN 8 connected = power supply

Figure 6

2 3 4 5 6

Connection for plug-in power

supply unit Plug-in power supply unit

Ethernet PC-Connection

PC or other IP-telephone

Ethernet-port of the pabx

elmeg pbx

Connecting to and operating the system telephone at the pabx system (basic function including DHCP)

Consult theinstallation instructionsfor thePABX systemto determinewhich portcan beused forconnec ting the IP-S400. Connect this port with the Ethernet PABX port on the system telephone.

•

ConfigureyourPABXsystemfor usewithIPsystemtelephones.

•

Definethe MSNsfortheIPsystemtelephoneswithinthe PABXsystem.

•

Switch onthe power (plug-in powersupply unit) to theIP system telephoneand wait until thetele phonehasbeeninitialized.

OncetheIPsystem telephonehasbeeninitialized youwillberequestedto selectthelanguagein thedisplay.

Description and installation

Selectthedisplay language.

•

Press the buttons to view the available langua ges.

EnteroneoftheMSNs thathas beeninputto thePABXsystem(intheexampleshown here,12) .

•

Confirm your entry by pressing

If no PIN has been entered in the system con figuration, press button

again after being requested to do so.

• Swtich toUse DHCP.

and button

. Programm dial number

Italiano

Deutsch

Français

MSN-1>12

MSN-1>

Which language?

Español

®English

Nederlands

IPS login PIN for sys

server

Select »on«. Use automatic IP

adress setting

off

on®

• The telephoneand PABXsystem aresynchronized.

Ifthere isnoconnectiontothe PABXsystem(no LANlink,or thetelephonehasnotbeen logged in),the symboll»©-----/ /----‰ «will beshowninthedisplay insteadofthe time.

You can now use the IP system telephone at the ISDN or UP0 port.

You find a complete description of the configuration on page 84.

Changing the label

The label panels for the function keys are included on a separate sheet enclosed in the operating instruc tions. Cut out the label you wish to use. To changethe label panel,press the flexiblecover togetherbetween your indexfinger and thumband lift it out. The label panel can now be changed. Youcan fillinthelabel foryourtelephonewith yourowninformationand thenprintitout usingtheProfes sional Configurator. Also available on theWIN-Tools CD-ROM is an Adobe Acrobatfile containing tem plates that you can also fill in and print out.

Description and installation

Pictographs

The pictographs (symbols) described below have been used in these operating instructions to illustrate some procedures for setting and using the telephone.

b Liftup thehandsetorstart prepareddialing. a Replacehandset.Thetelephoneis idle. l Acall issignaled.Theringer melodysounds. g Youare conductingacall. d Athree-party conferencecallisinitiated. q Youhear thepositiveornegative acknowledgementsignal. t Selectthe callnumber,code, character ortext. X Thissymbolpromptsyou toselectacertaindigitor character.

Presstheappropriatebutton onthepush-buttonset.

Setting the display language

You can select the language of your display.

Begin as follows:

Press the arrow buttons to view the available languages.

Press the softkey adjacent to the desired language. The display switches to the chan ged language immediately.

Msss

Configuration Display Language

Which language?

Italiano

Español

Deutsch

Franªais

English

Nederlands

Description and installation

Telephone display and buttons

Figure 7

1 Speaker 2 Handsetwithconnecting cord 3 Answering machinebutton on thetelephone (optional module). With the CS400,thepabx

menuwillbe loaded. 4 6Softkeys 5 Seven-linebacklit display 6 Menukey: Thiskey opensthe programmingmenu. If youare alreadylocated ina menuand

thenpressthekey,eithermenu-specificfunctionsareshown,oryouaremovedback onepro

grammingstep. 7 ESCkey:PressingtheEscbuttonduringprogrammingreturnsthetelephonetoitsidlestatus. 8 / 10

9 OKbutton:Pressingthisbutton confirmsanentryorstores asettinginthe telephone. 11 Ckey:Pressthisbuttontomovebackonemenustepinthemenu. Ifyouarecurrentlyinthein

»left«/»right«arrowbuttons: Thearrows»{«and»}«intherightcorneronthetoplineofthe

display indicate that you can call up further functions on the lower lines using the arrow

buttons.

putmode, thisbuttoncanbe usedtodeleteindividualcharacters.

Description and installation

12 Asteriskkey/hashkey 13 Dialbuttons 14 Openlistening/ hands-freebutton 15 Endingacall 16 Redialbutton 17 Inquiriybutton 18 Microphone 19 Eachbuttonhasaninsettwo-colorLED(level1-red/level2-yellow). TheseLEDscanbeused

toindicate certainfunctions. CS410:TheLEDs forthetwobottomkeysof(levels 1and2)have twocolors. CS410-U:The LEDsofallkeys havetwocolors(levels1 and2).

IP-S290:TheLEDsof allkeyshaveonecolor (level1). 20 Labelpanel forfunctionkeys 21 Status-LED,CallsignalingLED,receivedUUS andSMSmessagesandMWI(red) andanswe

ringmachine (yellow).Itispossible toconfigure thedesiredfunctional displayfor messages

andcalls.

Telephone display

Date

09.03.05 07:00

™Info -D-I-q-

™Tel. Drctry

™VIP

Caller list

Quiet

‰

1 2 Time 3 21 characters per line 4 Arrow: Further menu items accessi-

ble by using the arrow keys.

Figure 8

5 Answering machine button on the

telephone (optional module)

6 Arrow: Indicationof thesoftkey that

can be used in the current menu.

A checkmark »®« following a display text indicates that this feature is active.

The telephone is equippedwith a seven-line backlit display. Backlighting is automatically switched on or off. After connecting the system tothe internal ISDN connection ofyour PABX system, the date andthe time are shown on the display. The date and time are imported automatically from the pabx system. The text displayed for a function isalways located next to the corresponding softkey. When you press the softkey, the nextlevel isdisplayed. If notall information fitinto thescreen, thiswill beindicated by»««or»««. To have the other characters displayed, press the R-button first and then the corresponding arrow button.

Various telephone display shots are illustrated in this operator’s manual to helpexplain the different set tingsand useofthesystem. A wavylineat thetopor bottomofanillustrationindicates thatnotall ofthe7 li nes of that particular display are shown (only pertinent lines shown).

Description and installation

Special feature for displaying lists in the display

Severalentriesareshowninthe displayasalistfor certainsettingsorwhenusingthe phone. Theselists are required for telephone directory or VIP memory programmings for example.

<> The activeentry (the oneyou haveselected) is

highlighted. Use the menu or the OK button to display further features or select the high lighted entry.

Special feature for changing existing entries

You have various options available for changing existing entries (for example names or numbers).

Example 1: You may wantto change thetelephone numberof an entry, becausethat subscriber has movedto another place. When youuse the push-buttonset to enterthe first digitof the newnumber theexisting number isdeleted completely. Enter the other digits of the new number.

Example 2: You wishto change partsof a namein a telephonedirectory listing, becausethe name haschanged (e. g.in the case of marriage). Usethe arrowbuttons tospecify thestorage positionfor thatentry. Youcanoverwriteanexistingsurname right away or delete it with the C-button and then enter the new name.

VIP digit to select {}

V0: 0123456

V1: TONY

V2:

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Description and installation

Key assignments for entering texts

The assignments for the keypad for entering letters, digits and special characters are as follows:

Button Press Button 1234567

ABc 2ÄÅÆ

DEF3

GHI 4

JKL5

MNO 6 ÖØ

PQRS 7ß$

TUV8Ü

WXY Z 9 ¥

0 Severalspecialcharactersareassignedtothebutton»!«,»+«,»-«,»=«,»(«,»)«,»@«,»$«,. .

Whenyou pressthe 0 key thefirst timeaspace isinserted. When youpress thiskey asecondtimeseveral special characters are shown in the display. Press the appropriate key to select the corresponding special characters

Input mode for entering letters

You ha«.

»ABC« Thenextletter thatyouenterisshownasa capital,allothersassmall caseletters.

»ABC« Everyletterthatyouenter isshownascapitals.

Call signaling

Call signalingis effected usingthe ringingtone that hasbeen set forthe dialed number(MSN) in eachtele phone.

If youare usingthe telephoneat aninternal ISDNconnection ofcertain elmegPABX systems,you canpro gram special ringing melodies for internal and external calls.

1 … 9. If you wish to view further special characters, press the 0 key.

Example:»Dean, James«.

Whenyou startentering texts,theinput modeis always»Abc«.Press theRecallflashbutton to change the input mode. To insert a character while in »Abc« mode, press the C key.

Description and installation

Function keys and LEDs

Youcan programthefivefunctionkeys ontwo levelswithdifferentfunctionsviathePCconfigurationpro gram forthe telephone. Each key isequipped with anLED that isused to displaythe activefunction. Each color is assigned to a particular level for the function key. (level 1 - red / level 2 - yellow). Pressthe keytwotimestoreach thesecondlevelfor thefunctionkeys. Thismustbedoneat ashortinterval.

LED call signaling and answering machine

flashes red: Incomingcalls lit yellow: Answeringmachineswitchedon flashes yellow: Newmessagesrecordedbythe answeringmachine

Acknowledegement signals

Entries or settings you make at your telephone are sometimes confirmed by acknowledgement signals.

Positive acknowledgement signal (1 long tone):

The positive acknowledgement signal indicates that your input has been accepted and stored by the telephone.

Negative acknowledgement signal (3 short beeps):

You willhear thenegative acknowledgementsignal whenyour inputhas notbeen accepted bythe telephone, or when invalid input has been made.

Displays for programmed features

s When the telephone is in the idle state, addi-

tional information about functions that have beenconfiguredareshown on»Info«lineof the display. In this example: »-t-S-R-«. Press the softkey »Info« if you wish to get more information about the configured functions.

<> If you have programmed several features,

press the arrow buttons to view the various settings.

29.05.06 07:21

Info -T-S-r-

Tel. drctry

Idle

VIP

Caller list

ªªªªªªªªªªªªªªªªªªªªª

Inhibit/Menu access:

Guard for modification

Displays Configured function

»D«

Active appointment reminder set.

Description and installation

»I«

»q«

»Q«

»U«

»i«

»I«

»%«

Dialing control or Call filter active, Access to telephone menus is protected.

Function »Silent signalling« (notice tone only) active.

Function »Silent signalling« (all calls) active. (All call signals are switched off)

Call forwarding active.

Informationen on programmed function keys FOR EXAMPLE.: Message enabled / inhibited.

Informationen through Messages (MWI) For example. auf Ihrer t-Netbox

Answeringmachine,timecontrol, notificationorremoteoperation(option module)active.

Making Calls

Starting a call

Dial number - no correction possible

btg

Dial number

Dial call number - correction possible

atbg

Dial number

Tochangethe numberor tocorrect awrong entry,select thewrongfigurewiththe arrowbuttons andpress C to delete it. Now enter the correct number.

If youwish to conductthe callusing the handset,just lift itup after dialingthe number. Any timeduring a call you can switch back and forth between hands-free calling, speaker function and use of the handset.

Afteryou havedialedthe numberyoucan alsopressthespeakerecall flashbuttonto havethenumber dialed and to use hands-free calling.

If a callcan not be put through(e. g. number isinhibited via thedial ranges control, or theaccount for the number/MSNis empty),a correspondingmessage willappearin thedisplay. e.g.:»Inhibit. : dial

number«, when the dialing filter is active.

When you lift the handset and there is still no connection set up, you can pick up a waiting call using the softkey »pick up«without replacingthe handset again.You are notifiedof thecall inadvance by abrief message. When youconfigure a connectionkey or a macro keyyou can pick up a call immediatelyjust by pressing that key.

Other options for dialing without lifting the handset

Theoption ofdialing withoutlifting thehandset andof correctingor addingto anumber alsoexists during dialing:

fromthelastnumberredialing memory(see page21).

•

fromthecaller/memolist(seepage35).

•

fromthetelephonedirectory (seepage32).

•

fromtheVIPmemory(see page34).

•

withthefunction keys(seepage 66).

•

viaCTI(TAPI) features (seepage 97).

•

Ifyou areusing oneoftheseoptions, youcan makefurther entriespriortoinitiating thecall. Youcan define which number (MSN), if any, is to be transmitted to the party being called. You can use the Professional Systel-Configurator to set which function is to be assigned directly to the softkey »Telephone directory«: »Local« or »PABX«. You can reach the second function by pressing the R (Recall flash) key.

Dialing from the pabx telephone directory

Making Calls

When youuse thistelephone witha system telephony supportingpabx system,you can dialfrom the tele phone directory of the pabx.

Dialing from the telephone directory

You can store up to 250 names and numbers in the telephone directory. To select a name, you can page through the directory using the arrow buttons, or enter the specific first letter(s) of the name using the push-button set.

For informationon how toprogram and configurethe telephonedirectory, please referto page 32 ofthese operating instructions.

Dialing from the VIP memory

Youcan programVIP numbersforeachof theten dialbuttons1… 0including aname(20 charactersmax.) and a telephone number (26 digits max.).

drctry

Tel.

drctry

Tel.

Enter first letter Select

O<>O

entry

O<>O

entry

For information on how to program VIP entries, please refer to page 34 of these operating instructions.

Direct dial-in using function keys

Direct dialing isinitiated using the direct dialingkeys. Each of the fivekeys can be programmed withtwo functions or direct dialing numbers.

Use the function keys to select the desired number. Ifyou wishto diala numberfrom thesecondlevel,press thecorresponding keytwo times. This mustbe ex ecuted at a short interval.

You can program thedirect dialing / functionkeys via the PCconfiguration program for thetelephone or during extended configuration.

from Dialing from the caller/memo list

s<>

VIP

Select VIP

destination

Press the function key

tbg

Select VIP

destination

Thephone hasa combinedcaller andmemolist. Amaximumof 30entries (calls,memos, SMSmessages or UUS1- messages) are stored in this list. Entries in the caller or memo list are indicated by the »Caller

list« softkey.

Making Calls

Formore informationaboutthecaller/memolist, pleaserefertopage35 oftheseoperatinginstructions.

s<>

Caller list

Select entry

Accepting / rejecting a call

In itsinitial statethe telephonewill acceptall calls, regardlessof the selectedMSN. If twocalls aresignaled simultaneouslythe firstoneisaccepted whenyouliftup thehandset. Thesecond callcan stillbesignaledy a call waiting signal. Thetelephone displayshowsthe caller’snumberorthe numberthecaller hasdialed (MSN-1…MSN-10, or the assigned name).

albg

If you areunable, or do notwish to accept acall, you havethe option of rejectingthis call. Press the »re

ject« softkey and the call will be no longer be signaled at your telephone.

If you area member of ateam, then this callwill continue to besignaled at the phonesof your team. If the call was signaled only at your phone, the caller will hear the busy signal when the call is rejected.

reject

Call Deflection

If you are unable, or do not wish to accept a call, you have the option of forwarding this call. Press the softkey »transfer«,if youwish to forwardthis call directly toanother subscriber. The call number of the forwarding target can be preset for each call number (msn) when configuring the telephone.

Afterpressingthe »transfer«softkey, youcan forwardthe callto thepreset callnumber orenter anew call number.

transfer

Dial number

No number transmission (anonymous call)

You can block thedisplay of your telephone number atyour caller’s telephone if desired. You can set this function specifically for the next call, or permanently (see page 50).

Suppressing calling line identification for the next call

During anexternal or internal call,you can prevent thenumber from beingtransmitted (displayed)to the party you have called.

Making Calls

Dial number

Whena callissignaled,youcan decidebeforeacceptingthecall whetheryournumberisto betransmittedto the caller. If your phoneis the final destinationof call rerouting youcan use thisprocedure to prevent the caller from seeing the final destination phone number (i. e. yours).

OMs

Concealed

Starting a call with a fixed extension number (MSN)

You can conduct an internal or external call such that a defined number (MSN) is transferred from your telephone tothe party youare calling. This numbermust have beenentered previously inyour telephone. When you call, either number that is transmitted is shown in the second line of the display (»msn1... msn-10«) or the name that you have assigned to this number (MSN). Youcaninitiatedialingusing theset extensionnumber (MSN)as explainedin thefollowing,or youcan use a programmed function key for this.

Use the WIN-Tools telephone directory manager to set up and configure an MSN extension number to be used for outgoing calls.

Dial number

OMs s

MSN

MSN-1 … MSN-10

Redialing

The previously dialed call number is stored in the redial memory.

Extended last number redial

In the extended redialing function the telephone numbers of the last 20 calls, connections (calls) or text messages are stored. You can view these by pressing the redial button or the arrow buttons and subse quently have them redialed automatically.

The lastdialed numberis displayed. At theend of thesecond linethe statusof thisentry isindicated bythe letters displayed there.

WWO

Select entry

»v« Connection »r« Call »M« Mail(extensionnumbers,towhichSMS orUUS1messageswere sent) »|« Callsconfiguredforautomatic redialing.

Making Calls

no entry Youplaced acalltosomebodybutdidnot reachhim/her,or his/herlinewasbusy.

Deleting a telephone number from extended redialing or save as a memo

Press the softkey below »delete?«, to delete the displayed entry immediately. Press the »Memo?« softkeyto writetheentry asamemo tothememo list. Theentrywillthen bedeletedfromthememo list.The next telephone number is then displayed.

For an entry in the memo list, the softkey »Caller list« is shown on the display.

Importing numbers from extended redialing into the telephone directory

You can import a number that is present in the list for extended redialing into the telephone directory of your phone (see page 32).

Begin as follows:

WWM s

Select entry

delete?

WWMs

Select entry

Enter the name. In this example: »DEAN«. Confirm your entry with OK.

Input telephone book

Name>Dean`

Tel. drctry

Memo?

In the redialing function the name displays instead of the number.

Automatic redialing

If youplaced acall to asubscriber whosenumber isbusy orwho does notanswer, youcan thenactivate au tomatic redialing which will call that same subscriber again after about 10 seconds.

atg

Dial number Subscriber busy

Afteraround 10seconds thehands-freecalling functionof yourphoneis activatedand thenumberis dialed automatically. This is repeated for up to around 2 minutes.

Up to 20 call attemptsare made if thesubscriber can still not be reached. After 20 unsuccessful attempts, automatic redialing will be cancelled. You will hear the negative acknowledgement signal in that case.

5/DEAN v

Tel. drctry

repeat request

Autom.

memo?

Making Calls

If automatic redialing is active, the »Autom. repeat request« softkey is shown on thedisplay. Press therightarrowbutton orthe »Continue« softkey,toreturnto thenormal idle state display.

Suspending automatic redialing

You can suspendautomatic redialing that you havestarted any time using theappropriate procedure and placea normalcall. To suspendautomatic redialing,press theopenlistening/hands-free buttonduring au tomatic redialing. After the call automatic redialing starts again.

Deactivating automatic redialing

You can deactivate automatic redialing at any time. There are no further call attempts.

To deactivate automatic redialing during the dialing process press ESC.

If you like to deactivate automatic redialing in the idle state of the phone, proceed as follows:

Autom. repeat request ok

Microphone activation/deactivation, open listening and hands-free calling

Mute on/off

The mutefunction allows youto switch offthe handset microphoneduring a normalcall, or thetelephone microphoneduring handsfree calling. The subscriberyou arecalling willthenno longerbe ableto hearthe conversationyouconduct withpersons inthe room(room inquiriy). However, youwillcontinueto beable to hear the party on the phone.

Call duration and cost logging are continued even if the microphone has been muted.

Speaker function

The “Openlistening“ function canbe activatedwhen thereare other persons inthe room whowish to also participatein thecall.You continuetotalkinto thehandsetwhile thisfunctionis active. You cansetthe vol ume during the call as described on page 60. Please inform theparty you are calling thatopen listening is activated. »|«indicates that open listening is activated.

Mute speak

Room inquiriy

When youhang up thehandset while openlistening isactive, bothopen listening andthe call itselfare ter minated.

Begin open listening End open listening

Making Calls

Hands Free Calling

The handset remains in its cradleduring hands free calling. Thebuilt-in microphone and the speaker are activated. Any actions are carried out using the open listening / hands-free button only. You can switch back to normal»handset« calls at anytime during hands freecalling by merely liftingup the handset. You can also switch from normal »handset« calling to hands free calling when you hang up the handset after pressing theopen listening /hands-free button. During hands-freecalling acousticsignals such asthe call waiting signal are not transmitted. Pleaseinform theparty youare callingthat hands-freecalling isactivated.»|« showsthat handsfreecalling is activated.

Begin hands free calling Dial number End hands free calling

Headset use

Youcan connectaheadset toyourtelephone.Connect andconfigurethe headsetasdescribedonpage 6. You can use the handset or the headset for making calls.

Activating and deactivating the headset

Forheadsetoperation, oneof thefunctions buttonsmust beconfiguredas aheadset key. The LEDassigned to this key indicates, whether the headset in switched on or off (LED on or off).

Activating and deactivating open listening while using the headset

Call via headset Activate open liste

activate headset Dial number Call via headset Deactivate headset

ning

Call via headset and

open listening

Deactivate open liste

ning

Call via headset Deactivate headset

Announcement

Themessage functionallows youtoestablish aconnection toadifferent telephone,without thisconnection havingto beactivelyaccepted (pickingupthe handset,hands-free callingorloudspeaker). Thisisa simplex (one-way) call in which only the subscriber that initiated the message will be heard. As soonas atelephone acceptsthe message, the connectionis established. Fora messagecall, enter the in ternal numberof theparty youwish tocall. You alsoonly needto enterthe internalnumberwithdirect ex change line access. e.g. »22« instead of »*22«.

Whena messagecomes inforyourtelephone,the numberor thenameofthe partysending themessage ap pears in the display. The message can be terminated at any time by pressing the ESC key. Messages are accepted automatically by the phones being called byactivating the open listening function when:

thephoneis idle.

•

messaging has been enabled for the pabx (control by means of the »Enabling intercom« function

•

key). the»Silentsignalling« functionis notactivated.

•

Making Calls

Messages canalso be receivedeven ifthe »Station guarding«function is active whenthe »Enablingmessa ges« function key has been programmed and is activated.

You caninitiate amessage usingthe proceduredescribed below,or usinga programmedfunction key.You can also initiate a message during an ongoing call (inquiry call) using the corresponding function key.

Youcan onlyutilize thisfunctionif themessaging featurehasbeen enabledinthepabx foryour MSN extension number.

Begin as follows:

t Enter the telephone number, for which the

message isto be given,or select anentry from

the telephone directory.

As soon as a telephone accepts the message,

the connection is established.

Press the openlistening/hands-free button to

end a message.

Ms>s

Acoustic Message

| Message to

MSN-1

Tel. drctry

| Message 22

00.24 MSN-1 Display

memo

Intercom

The intercomfunction allowsyou toestablishan internalconnection toanother systemtelephone without the called system telephone having to accept the call actively (lift up handset, hands free calling/activate open listening). This is a call in which both parties can speak to one another. As soonas the system telephonehas accepted theintercom call, theconnection is established.If oneof the parties picks up the handset during an intercom call, the call becomes a standard type of call.

Foran intercomcall, entertheinternal numberofthe partyyou wishtocall. You alsoonly need to enter the internal number with direct exchange line access. e.g. »22« instead of »*22«.

Whenan intercomcall comesin foryour systemtelephone, thenumber orthe nameofthecallingparty ap pearsin thedisplay.The intercomcallcanbe terminatedatany timebypressingtheESC key. Intercomcalls are accepted automatically by activating the »Hands- free« feature when:

thetelephoneis idle,

•

the intercom feature hasbeen enabled for thepabx (control by means of the »Enablingintercom«

•

functionkey). the»Silentsignalling« functionis notactivated.

•

Intercomcallscanalsobereceived evenif the»Station guarding«function isactive whenthe»Enableinter com calls« function key has been programmed and is activated.

You can initiate intercom calls using the following procedure, or using a programmed function key.

You canonly utilize thisfunction ifthe intercomfeature for systemtelephones has beenenab led in the pabx for your MSN extension number.

Making Calls

Begin as follows:

t Enter thetelephone number, forwhich thein

tercomfunction isto beactivated, or selectan entry from the telephone directory.

The connection is set up when the telephone has accepted the intercom function. To end the intercomfunction, press the open listening/hands-free key.

Ms>s

Acoustic Intercom

| Speak to

MSN-1

Tel. drctry

| Intercom 22

00.25 MSN-1 Display

memo

Automatic completion of call

Using theautomatic completion ofcall to busysubscriber feature, youcan reach asubscriber whose lineis busy orwho is not nearhis or hertelephone. You arethen notifiedthat the subscriberfor whichrecall has been configured can now be reached. You receive this information from the exchange office for external call-backs and from the PABX system for internal call-backs. The telephone display then indicates »Autom. callback«. This display alternates every 2 seconds betweenthe numberornameof thedesiredparty. As soonasyou acceptthisinformation (bypickingupthe handset, for example), the selected party is called automatically.

Automatical recall to busy subscriber (CCBS)

You hear thebusy signal whencalling the extension ofthe person you aretrying to reach. »Completion of call tobusy subscriber«allows you to callthe extension as soonas the othersubscriber hangsup his or her telephone.

Automatic completion of calls on no reply (CCNR)

When you call the desired number you always get a ringing signal, but the party is not near the phone or does notanswer. Using thefunction»Completion ofcall onno reply«you canreach theparty immediately when he/she ends a call, or lifts and then replaces his/her handset.

Programming completion of call to busy subscriber

btg

Dial number Subscriber busy or does

not answer

The »Clbckbusy« softkey is only displayed, when automatic completion ofcalls are possible with the exchangeoffice orwith thepabx.Thefeatures »Recallto busysubscriber«or»Recall onno answer«mustbe applied for at your service provider for external call-backs.

You canconfigure threecall-backs at atime. If you areusing anLCR procedure (e.g. theLCR procedureof thephone), the»Completion ofcall tobusy subscriber«function iscarried outautomatically viayour stan dard network service provider.

Clbckbusy

Making Calls

Ifautomaticredialingisactive,the»Clbckbusy«softkey isshown onthe display. Pressthe right arrow button or the »Continue« softkey, to return to the normal idle state display.

Viewing and clearing call-back calls

When thephone is inidle, any call-backcalls that are initiatedcan be viewedin the displayby pressing the softkey »Clbckbusy«. Press this softkey to view the call-back calls. You can then view the individual completioncalls usingthearrowkeys. If youwish todeletea callcompletion, selectthiscall usingthearrow key and then press the menu key, followed by the »delete?« softkey.

All completions of call are automatically deleted after a predefined period. This time is set by the service provider for external call-backs and by the PABX system for internal call-backs.

Ifthe ISDNtelephone isdisconnected fromthe ISDNnetwork, (forexample byunplugging the ISDN connectorof the phoneor byswitching offor resetting thepabx), allrequested call com pletions will be lost.

Parking a call (not with IP-S400)

Theparking functionallowsyouto interrupta callforupto threeminutes. Youcanthen unplugtheplug-in connector foryour ISDN systemtelephone from theISDN jack andplug it inin adifferent room. You can continue withthe previous callafter »unparking« it. Or youcan »unpark«the call ata different phoneand continue your call there.

Parking is only possible whenonly one connection is currently active with your telephone. After you unpark the call, the number for the parked subscriber will no longer be shown.

A»parking code«(0.. ..99) isusedtoensurethat youarereturned totheproper callwhentwocallsare park-

ed. The default parking code is 55.

Ifyou parktwocalls onanISDNbusthis busisthendisabled forfurthercalls. Unparkingis possibleonly onthe buson whichthe callwas alsoparked. Parking isonly possiblewhen onlyone connection is currently active with your telephone.

Park

Conversation

Unparking

park

Enter park code

Disconnect and then

reconnect

Tracing (MCID)(only via ISDN cord)

If you receive aprank or malicious call, you can arrange forthe number ofthe caller to besaved at the ex change. To enable this feature (Malicious call identification), it must first be applied for at your network service provider.

unpark

Enter park code Conversation

Making Calls

Identification of thecaller is effected in theexchange and the number storedthere with infor mation on the number of the caller, the date and the time of the call.

You can use this feature in 2 situations.

Malicious call identification during ongoing call

You want to identify a cal

Call with subscriber

After the caller has hung up the handset

You wish to determine the caller,

Call with subscriber

You can initiate tracing only in the course of an ongoing call when you are conducting hands-free calling using the telephone.

but he/she has already hung up the

ler.

handset.

mcid

The telephone number

can then be established in

the exchange.

The telephone number can then be

established in the exchange.

Keypad and tone frequency dialing (DTMF dialing)

During anongoing callyou can takeadvantage ofother featuresusing keypadsequences orDTMF dialing. Inthe telephoneconfiguration programyou canset whetherecallflash buttonpadsequences or DTMFdialing is to be possible in the initial status of the telephone. The display indicates which other functions (keypad or DTMF) are possible.

»Keypad« softkey is displayed. DTMF sequences can be entered right away and keypad se-

quences only after you press this softkey.

»DTMF« softkey is displayed. keypadsequencescan beentered rightaway andDTMFequen-

ces only after you press this softkey.

Keypad andDTMF sequences canalso bestored forfunction keys, whichcan thenbe used du ring a call.

Keypad

Usingthe Keypadfunction youcan manageservice or featuresin thePABX systemor in thenetwork ofthe serviceprovider byenteringcharacter stringsanddigitsequences viathekeypad. Ask yournetworkservice providerabout thisandconsult themanualforyour PABXtodetermine whether“Keypad“issupported.

Tone dialing (dtmf dialing)

Using tonefrequency dialing,you can transmitmultifrequency signals(DTMF signals)during anongoing callinorder, forexample, topoll youranswering machineorfor usingmailsystems. If callwaiting isactive for an ongoing connection, tone frequency suffix dialing can not be utilized.

keypad

Input of character strings and digit sequences

Conducting calls with several subscribers

DTMF

Input of character strings and digit sequences

Conducting calls with several subscribers

Call waiting

If, duringan ongoingcall, asecond callcomes infor you, thesecond callis signaled when„Call waitingon“ is set (see page 68 ).

Call with subscriber 1

Youcan takeawaiting caller,rejectthe call,orswitch toadifferentsubscriber.You cannottransfer anycalls if you already have four calls on your phone.

You can take a waiting caller, reject the call, or switch to a different subscriber. You can not transfer any further calls if you already have four calls on your phone.

call waiting

(subscriber 2)

Call with subscriber 2;

Subscriber 1 is put on hold

Inquiry Call

You have the option of establishingup to two other connections during an ongoingcall using the inquiry callfunction.You canalso usethe MSNassignment key,a linekey oran extensionkey toinitiate aninquiry connection.

Call with subscriber Subscriber 1 in hold condition Dial call number Call with subscriber 2

If you wish to set up further connections, proceed as described above. Anactive connectioncan beterminated bypressing thekey forendinga call.You canreturn tothe callthat was previously put on hold. If there are no other calls on hold, a new connection can then be set up.

Transferring a call to a busy subscriber

This performance feature is possible when only one call is on hold. You would like to transfer a sys tem-parked inquiry call to a busy subscriber.

Call with subscriber 1 Subscriber 1 is put on hold Dial number Subscriber 2 is busy

Thesubscriber onhold willhearMusicon Hold.As soonas subscriber2hangsup, he/shewill berecalledby subscriber 1.

transfer

Replace handset.

Conducting calls with several subscribers

Call switching

When a call is transferred, the active subscriber and the subscriber for the connection previously put on hold are always connected with one another.

Youcan initiateaninquiriycallyourself (e.g.inordertoannounce thecall)andcanthen transferthecall.

Call with subscriber 1 Subscriber 1 is put on hold Dial number Call with subscriber 2

Please notethat the feature(ECT - ExplicitCall Transfer) mustbe supported bythe PABXsys tem whentransferring two (2) externalcalls, or, whenyou use your phonedirectly on thenet work termination unit, by your network service provider.

transfer

Broker’s call

If you havemore than oneconnection active atyour telephone (callwaiting or inquiriycall) (max. offour connections), youcan talkto these partiesalternately (Broker’scall). For this, thereare upto four softkeys available, depending onthe number of connections onhold (»conn1«,. .. »conn4«). If the numberor the nameof theother partyis known,the associatedname or numberis shownin thedisplay instead ofthe text »Connection«.

Call with sub-

scriber

Connection 1

...

Connection 4

Call with desired

subscriber

Connection 1

...

Connection 4

Call with desired

subscriber

Ifyou haveconfiguredextension andlinekeys youcan alsocarryout Broker’scallsbetweendifferent callers using these keys. To terminate an active connection, press the disconnect key. You are then returned to the call that was previously put on hold.

You havethe option ofconfiguring up tofour »Connectionkeys« inaddition to thesoftkeys for thesystem telephone orthe additional keypad.In connectionwith theassociated LEDs, this keys showthe communi cation status (no connection, ongoing connection, call status).

Three-party conference

Ifyou havean activeconnection anda connectionon holdat your systemtelephone, youcan initiatea con ference call with these two subscribers. All three subscribers can speak to one another. Conference calls are not possible with more than two (2) connections at your phone.

Call with subscriber 1/

subscriber 2 is put on hold

Conference Conference with subscriber 1 and 2

Conducting calls with several subscribers

To end the three-party conference, press the softkey »back_to_«. You are reconnected with the sub scriber of the last previous active connection. The other subscriber is put on hold.

Telephone operation

Telephone directory

Ifthe nameof thecalleristo beshown inthedisplay insteadof thecaller’s number,thisnumber mustbeen tered in thetelephone directory with thatname. Thetelephone numbermust bestored with thearea code and with the line access digit when using with a PABX system. Displayof thecallernameisonlymadewhenthetransmittednumbercorresponds tothenumberstored in the phone directory.

If the telephone is disconnected from the ISDN network and then reconnected, or if the data for the tele phone directoryare transferred tothe system telephonevia thePC program,the directory mustbe reorga nized internally. This processtakes place automatically and mayrequire a few minutes.During this time, the telephone directory of your telephone is not available for use.

Settings for telephone book entries

Name and number

Eachtelephonebookentryconsistsof aname(20 charactersmax. )and anumber (26digits max.). The assignments for the keypad for entering letters, digits and special characters are described on page 12.

Outgoing number (MSN assignment)

You can assign anumber (»MSN-1«…»MSN-10«) to each entry (MSN) thatis to be transferred to the partybeing calledforoutgoingcalls. Tosetup aconnection withthisMSN prefixfirstdial thenumberinthe telephonedirectory incall preparationandthen liftup thehandsetof yourphone. Ifyouestablish aconnectionusing anMSNassignmentkey thenumber(MSN) forthiskeyisdisplayed attheparty youarecalling.

To define the number(»MSN-1« ...»MSN-10«), that is to be displayed at the party being called, use the telephonedirectory programon theWIN-Tools CD.If youdo notassign anumber toan entry,or assignan incorrect number (one that is not in the phone directory), the first number entered for the telephone is transferred (»MSN-1«).

Special dial tone

Youcan programaspecial dialtoneandfor eachentryand setthevolume separately.Acallis signaledusing the set specialringing tone whenthe caller alsotransmits the corresponding number.This special ringing tone will then have priority over the ringing tone assigned to the selected MSN.

Infotext

You can store an info text for each entry. The information text is displayed when:

atelephonedirectory entryhad beenselectedincallpreparation usingtheOKkey.

•

whena callissignaledand thesoftkey »Info«is pressed.

•

Duringa connection whenthesoftkey »Display« ispressed.

•

Telephone operation

Theinfo textlengthis restrictedto 42characters. Theassignmentsfor thekeypad forenteringletters, digits and special characters are described on page 12.

Add an entry to the telephone directory

Begin as follows:

Editing phone directory entries

Begin as follows:

Enter the name. In this example: »Mustermann«. Confirm your entry with OK.

Enter the telephone number. In this example: »0123456«. Confirm your entry with OK.

Ms s s

Program nos. Tel. drctry New

Input telephone book

Name>Dean_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Input telephone book

Number>0123456_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

O<> O

Program nos. Tel. drctry List

<t O

Deleting a phone directory entry

Begin as follows:

Change the existing name as described on page 12. In this example: »Dean, James«. Confirm your entry with OK.

Change the MSN extension number as de scribed on page 14 In this example: »01122334455«. Confirm your entry with OK.

Mss s

Program

nos.

Tel.

drctry

delete

Enter first

letter

Change tbook data input

(Abc)

Name>Dean, James

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Change tbook data input

Number>01122334455_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Enter first letter Select entry

O<>O

Select entry

Telephone operation

Programming special dial tones (VIP-tones) for telephone directory entries

Begin as follows:

<> O

Msss<>O

Program

nos.

Press the arrow buttons to select the ringing tone melody. Confirm your entry by pressing ok.

Use the arrow buttons to set the volume. Confirm your entry with OK.

Tel. drctry Sp. ton.

Programming an info text for a telephone book entry

Begin as follows:

call

Select entry

Dean, James{}

Melody 12

----------©-----------

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Dean, James{}

volume

- ©©©-- +

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Ms s s

Program

nos.

Tel.

drctry

Info

Enter first letter Select entry

t Enter the corresponding data for the tele-

phone book entry. Confirm your entry with OK.

Add. info. for tbook

Senior engineer,testcom Birthday15.05.1955_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

O<> O

entry

VIP-Memory

Youcan programVIPnumbersfor eachofthe tendialbuttons 1… 0includinga name(20characters max.) and a telephone number (26 digits max.

Programming VIP entries

Begin as follows:

M s s s <> O

Program nos. VIP New

Select VIP destina

tion

Telephone operation

Editing VIP entries

Begin as follows:

Enter the name of the VIP target. In this ex ample: »DEAN«. Confirm your entry with OK.

Enter the telephone number. In this example: »012345«. Confirm your entry with OK.

M s s s <> O

Change the existing name as described on page 12. In this example: »Dean, James«. Confirm your entry with OK.

V0>Dean_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Program VIP number

V0>012345_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Program nos. VIP List

V0>Dean, James_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Program VIP name

program

Select VIP destination

Program VIP name

Change the MSN extension number as described on page12. In this example: »01122334455«. Confirm your entry with OK.

Program VIP number

V0>01122334455_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Caller- and Memo list

The phonehas acombined caller andmemo list.A maximum of30 entries(calls, memosSMS messagesor UUS1- messages) are stored inthis list. Entries in the caller or memo list are indicated bythe »Caller

list« softkey. You always have the most current entries in the list. The most recent entry is displayed

first. When youpress this softkeythe number ofnew entries isshown on thedisplay (for example:4!«) together with the number of new SMS- or UUS1-messages (for example: »Messages: 2«).

Alsoshown infront ofeachentry isthe numberforthat entryin thelistand thetotal numberofall entriesin the list.

FOR EXAMPLE. : »3/10: 1122334455...... *«.

If thenumber inthis entry is identicalto a number inthe telephone directory (phonedirectory of the tele phoneor thepabx) thename isdisplayed insteadof thenumber. You canalso viewthe timeand thedate of each entryas wellas information(if applicable)about it. If youlift up thehandset ofyour phone whileyou

Telephone operation

areviewinganentry inthelist,thatcaller isthencalledautomatically. Single entriescanbeselectedfor dele tion.

Caller list

Calls that you do not accept, or that you specifically refuse, are stored in the caller list. When acall is madewith a subscriberfrom the callerlist (you callor youare called), theentry is automati cally deleted and transferred into the redial memory.

Memo list

Youcan storea telephonenumber underascratchpad memo. Youcan notinput lettersor anyotherspecial characters. When a call is madewith a subscriber from thescratchpad list (you call or youare called), the entry is automatically deleted and transferred into the redial memory. You can enter a memo during a call or in the idle state. The following entries in the list are possible:

Manualentry.

•

Telephonenumber fromshort dialingmemory.

•

Telephonenumber fromdirectory.

•

Telephonenumber fromdirect dialingmemory (Functionkeys).

•

Numberfrom theredialing memory.

•

SMS / UUS1 messages

When you receive a new message the number of messages you have received up to that time is displayed when thetelephone isin theidle state. The phonenumber, or thename ofthe partywho sent themessage, and informationabout thetype ofmessage (SMSor UUS1)are shownin thecaller list. When youpress the menukey youcan readthereceivedmessage immediately,or saveitinthe listof SMSorUUS1messages for reading at a later time. Afteryou viewa newmessagethat islocatedin thelist ofsavedUUS1 orSMS messages,thatmessage isthen deleted from the caller list.

UUS1 Inhibiting filter

Usethe ProfessionalConfigurator orthe systemtelephone toinhibit orenablereceptionofinternaland ex ternal UUS1 messages. MWI - Message Waiting Indication (e.g. T-NetBox).

TheT-NetBox isan answeringmachinethat canbeprovided withinnetworksof theDeutscheTelekom AG, T-Com (GermanTelecom, T-Com).With theperformance feature MWI(Message WaitingIndication) ac tive you will be notified when a new message is received by yourT-NetBox. The notificationis stored asan entry inthe callerlist. Byselecting theentry andlifting thehandset youcan set upa connectionto yourT-NetBox tolisten tothenewmessagefor example.The entryin thecaller listis deletedautomatically ifnonew messagesarepresent, forexampleat yourT-NetBox.You canalsodelete the entry manually. You canonly use thisfunction when yourISDN connection andyour phone systemsupport theMWI per formance feature.

Viewing the caller list

Telephone operation

Theupper displaylines showthe typeof entry (»Call«, »Memo«, »UUS«,»SMS« ),the date(for thefirst two days »Today« or »Yesterday«), the time and the dialed extension (msn).

»*« »r« »n« »i« »I«

The telephoneis idle. The softkey»Caller

list« in the lower row of the display indi

cates that an entry is present in the list. Press this softkey.

The bottomlines showthe entriesavailable in the caller list. The active entry (the one you have selectedwith the arrowbuttons) ishigh lighted.

Newcall, UUS1 orSMStextmessage Call Display Callignoredby call filter Informationaboutnewmessages,for exampleinyourT-Netbox(MWI)

UUS:2 08:00 {}

Tel. drctry

VIP

Call Today {}

07:21 MSN-1

1/09:Miller office *

2/09:TONY * 3/09:123456 n 4/09:Purchasing *

Idle

Caller list

Whenyou viewthe callerlist again,entries thatyou havealready viewedbut notdeleted areno longer marked by »*« on the display, but rather by »r«.

<> You can view other entries using the arrow

buttons.

Further information about a call / memo

<> M

If you wish to view more information about the entry,select theentry using the arrowkey and then press the menu button.

s You can delete the phone number, import it

into yourtelephone directory, orview further information about the selected entry. You may want to press the softkey »info« for example.

UUS Yesterday {}

15:24 5/09:112233445566 n

6/09:Sales *

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Call Today {}

07:21 MSN-1

1/09:Miller office *

2/09:TONY *

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

1/Miller office }

Call today 07: 21

MSN-1-1 Info Tel. drctry

delete?

continue

Telephone operation

C Thedisplay nowshows informationaboutthe

call. If not all information fit into the screen, use the arrow keys to display more. Pressthe C-buttontoleave themenu. You can then use any one of the other options.

»delete?« The entryisremovedimmediately. »info« Viewingfurtherinformation aboutthecall.

FOREXAMPLE.: TheMSN extensionnumberto whichthemessage wassent andthe

telephonenumberof thesender. »Tel. drctry« Enteringthe numberofthecallerinthe phonebookofthe phone. »continue« Viewingthenextentryinthe callerlist.

Further information about a text message (SMS / UUS1)

<> M

If you wish to view more information about the entry,select theentry using the arrowkey and then press the menu button.

1/Miller office

0123456789 to MSN-1 (& MSN-2) Call today 07: 21 ( 2 x Call)

UUS Yesterday {}

15:24 msn-5 5/09:112233445566 n

6/09:Sales *

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

s Press the softkey »read«.

Note: Pressthe right arrowbutton to havethe »Tel. drctry« softkey displayed.

C The arrow (»{«) in the top row indicates an

incoming text message.

<> O

»save« Saving themessagein thecorrespondinglistof messagesand deletingtheentry inthe

If themessage isnot displayed completelypress thearrow keys toview therest of the message. Pressokifyouhavefinishedreading.Youcan thenuseanyoneoftheother options.

callerlist.

1/Sales}

UUS Yesterday 15:24

msn-5 Info read

Save

delete?

continue

* UUS 01/03 †

Sales Thanks! Let’s meet at 15.30

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

»delete?« The messageisdeletedimmediatelyand addedtoalist ofmessages.

Telephone operation

»info« Viewingfurtherinformation aboutthemessage.

FOREXAMPLE.: TheMSN extensionnumber towhichthemessagewas sentand the

telephonenumberof thesender. »Tel. drctry« Enteringthe numberofthecaller inthephonebookofthephone. »continue« Viewingthenextentryinthe callerlist.

Deleting the caller / memo list

Deleting an entry

Deleting all calls

You candelete allentries of thecaller /memo listsimultaneously. Text messagesyou havereceived (SMS/ UUS1) will not be deleted.

Caller list

Entering the number of the caller in the phone book of the phone

Begin as follows:

Enter the name. In this example: Dean. Confirm your entry with OK.

s<>M s

Caller list

Select entry

delete?

s <> M>s

Select the entry you wish to

delete

Delete all

calls?

s<>M s

Caller list

Select entry

Input telephone book

Name>Dean`

Tel. drctry

The memo or caller list then displays the name instead of the number.

Entering a memo

You can add a memo number from:

thetelephone’sphone directory(»Tel. drctry«)

•

thedirectdialingmemory/functionkeys(»direct«softkey)

•

theVIPmemory (»VIP«softkey)

•

therediallist(»redial«softkey orredialbutton)

•

oradd anew numbermanually(»new«softkey).

•

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

5/Dean

Call Today 08:12

Info

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Telephone operation

The following example describes how to add a new number as a memo.

Begin as follows:

>ss

Display New

Memo number create

>0123456_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Enter the number you wish to store as a memo. In this example: »0123456«. Confirm your entry with OK.

SMS and UUS1 text messages

With this phone you can send and receive SMS or UUS1messages (SMS - Short Message Service, UUS1 Userto UserSignalling). You caninput atextmessage usingthe keypadon thephone. Theassignments for the keypad for entering letters, digits and special characters are described on page 12.

Sendingandreceivingoftextmessagesis onlypossible whenthesender hashis/her numbertransmitted to the receiving party, where it is also displayed. This is why text messages are not transmitted, or not dis played on the telephone, when the phone number is not transmitted with the message.

Anincoming textmessageis signaledby twobriefacoustic tonesinthephone. If thephoneis idle,the number of messages received is displayed, along with information about these messages in the caller list.

SMS Text Messages (subject to terms of network provider)

SMS allowsyou to sendand receive textmessages to/from otherphones in afixed-line network orto/from cellphones. AnSMSisrestricted to160 characters, Upto 4SMS messageswith612 characterscan belinked automatically. A softkey confirmation is required to switch from one SMS to the next.

Sending/Receiving of SMS messages is only possible:

Whenyou usethis telephonewith asystem telephonypabx systemthat supportsthe SMSfeature.

•

Whenyou haveregistered thisfeature atyour networkservice provider,or theprovider ofthe SMS

•

centerforyour ISDNconnection. Whenthe phonenumber forthe SMScenter isstored inthe telephone.

•

Consult theprovider of theSMS center thathas beenconfigured toestablish in whichnetworks (fixed-line ormobile communicationnetwork) SMSmessagescan besent andthecostsforsending andreceiving SMS messages. This telephonedoes notsupport thetransmission ofSMS messageswith specialcontent (forex ample images, audio).

Thetelephone storesall SMSmessages youhave receivedor sentin twoseparate lists. Upto 10sent and10 receivedSMS messagescanbestored. Youcansavea maximumof5 linkedSMS (regardlessofwhether they are doubleor quadruplelinked). Phonesthat donot supportlinked SMSs receivethese asindividual SMSS messages.

Please notthat free storage spacemust be available toreceive SMS messages. You can not receiveany fur ther SMS text messages if you already have 10 SMS messages stored.

SMS messagesyou havesent can bestored ina list. When thislist isfull theSMS thatwas sentlast isstored temporarily.

Telephone operation

UUS1 text messages

Youcan sendtextmessages fromonetelephone toanotherwithouthaving tocallthat particularsubscriber. UUS1 text messages are limited to 31 characters.

UUS1 textmessages canalso besent tointernaland externaltelephones. You can onlyuse this feature with externaltelephones if »UUS1(User to UserSignaling)« has beenapplied for (and approved) for your ISDN connection.

Note that all terminal devices that are used (telephones, pabx systems) must support the feature »UUS1 (User to User Signaling)«.

Thetelephone storesallUUS1 messagesyouhavereceived orsentintwo separatelists. Upto 10received an 10 sent UUS1 messages can be stored.

Pleasenot thatfree storagespace mustbe availableto receiveUUS1 textmessages. You cannot receiveany further UUS1 text messages if you already have 10 UUUS1 messages stored.

UUS1 messages youhave sent can be storedin a list. When this list is fullthe UUS1 text messagethat was sent last is stored temporarily.

Creating and sending text messages Creating and sending text messages

Youcansend atext messageto anumber storedinyourtelephone(telephone directory,VIP memoryor directdialing memory),orinput anewnumberfor sending. Todo this,pressthe correspondingsoftkeyin the menu »Send mail»Tel. drctry«, »direct«, »VIP«, »New« or »Redialing«. Toselecta numberassigned toa functionkey (»direct«)orstoredundertheredial button, youcan also press that corresponding key.

When sending text messages the first number (»MSN-1«) entered in the telephone or the number specified by means of the userecall flash button are transmitted with the message.

Begin as follows:

Example: Creating a UUS1 text message

Enter the text. In this example: »Meeting 9. 30 to

11. 00 George«.

Confirm your entry with OK.

>sss

Message

SMS or UUS

Send mail

UUS>Meeting 9. 30 a. m. to 11. 00 a. m. George_

Send mail

s Press the corresponding softkey to select a

number stored in your telephone, or press »New« to enter a new phone number. FOR EXAMPLE.: »New«.

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Send mail/UUS

Repeat

Tel. drctry

New

VIP

direct

Telephone operation

s Finally, you can store the text message in the

Important notes for entering numbers with SMS transmission

If the»Direct exchange lineaccess« feature isswitched off foryour telephone, thenyou must enterthe line access digit before the target number. The line access digit must be stored in the telephone. Whenthe telephoneis connectedto apabx for whichdirect exchangeline acceshas beenprogrammed, the you can dial the target number directly.

Sending an interlaced SMS

Youcan linkupto4 SMStogether. Acounterin thedisplayindicates theremainingspace availableforchar acters. At the end ofthe first mail a query is made askingwhether a linked mailis to be sent.If you replay with Yes,a messageis then shown indicatingthe remaining freespace; if you answerwith No, theinput of the last character is ignored and the SMS is sent as described for non-linked SMSs.

Enter the telephone number. FOR EXAMPLE.: »2200«. Confirm your entry with OK. The text mes sage is transferred to the defined recipient.

appropriate list (»ok« softkey) or keep it in the temporary memory (»No« softkey).

Define targt. numb

>2200_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Save memo?

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

In the exampleshown here» 451 avail-

able« indicates the remaining space for

charactersstill available, 1/2 denotes that1 is the first SMS block, of 2.You can move between the blocks using the arrow key. If no space is availablefor saving a linked SMS, the message will only be stored temporarily.

Viewing newly received text messages

A new message can be displayed from the caller list (see page 35) or from the received text messages list. Onceyou haveread amessage fromthe listof temporarilystored textmessages, itisdeleted fromthe caller list.

Viewing received or sent text messages

The following features are available when viewing temporarily stored text messages:

Resendinga textmessage.

•

Youcan edita textmessagebeforeactually resendingit. Deletinga textmessage.

•

Enteringthe number,towhich thetextmessage wassent orfromwhich itwasreceived intothetele

•

phonesdirectory. Puttinga textmessageinto thelist ofpermanently storedmessages (UUS1only).

•

451 free 1/2 (Abc) You can link up to 4 SMS messages together. A counter in the display space indicates the remaining available for character

Send mail

Begin as follows:

Telephone operation

Example: Reading a received UUS1 message

Themost recentlyaddedtextmessage isdisplayedfirst. Anew, unreadtextmessage ismarked withan»*«. The following information can be displayed for a text message:

•

<> O

<> In the upper row of the display you see the

>s s s

Message

Nmberof thetext messagein thelist (inthis example:»01/06«). Received(»†«) orsent (»‡«)text message(in thisexample: »†«). Number,forwhichthetext messagewas sent(in thisexample: »msn-1«). Numberof thesender /receiver (inthis example:»2200«).

Press the arrow keys to view the entire text messages. PressOK toaccess thenextmenu withfurther options.

dateand thetime, whenyoureceived themessage. To select an action, press the corresponding softkey.

SMS or UUS

* UUS 01/06 †

MSN-1 2200 I’LL PROBABLY BE 30

MINUTES late.

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

UUS 01/06 today} † 10:36 MSN-1

send

read,Inbox

read,Outbox

Save text

delete?

continue

»send« Editingand thensendingthetext message.

To sendthe textmessage, please proceedas describedfor »Creating andsending text

messages. »delete?« Deletingatextmessage. »Tel. drctry« If you wishthe sender’s orreceiver’s number storedin the telephone directory,press

the right arrowbutton and thenthe »Tel. drctry« softkey. Enter thename for

thephonebookentry andconfirmbypressing OK. »continue« Viewingthenexttemporarilystoredtextmessage. »Text

Save«

(UUS1 only)

Permanently stored text messages (UUS1 only)

You can store up to five UUS1 text messages permanently in your telephone.You can then edit, delete or send these text messages. You can only input these messages directly into your telephone.

Movingthe textmessagetothelist ofpermanentlystored message. Todo this,usethe

arrowkey toselectthestorage locationandconfirm bypressingOK.

Telephone operation

Begin as follows:

>s s s

Messages UUS Specify the text

<> Pressthearrow keystoselect atextmessage. Select text {}

2: 3:

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

O PressOKto enterorchangethattextmessage.Confirm yourentriesbypressingOK.

M Press the menu key to send or delete a mes

sage.

»send« Editingand thensendingthetext message.

To sendthe textmessage, please proceedas describedfor »Creating andsending text messages«.

ªªªªªªªªªªªªªªªªªªªªªª

send

delete?

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

»delete?« Deleting atextmessage.

Automatic sending of text messages (UUS1 only)

You can senda UUS1 text messageautomatically to a caller. For this, message 1in thelist of permanently stored messages is used.

Begin as follows:

s Press the softkey »Incoming«, to acti

vate/deactivate automatic sending of mes sages. »Incoming«: automatic sending active. »Incoming«: automatic sending not ac tive.

Configuring the text message reception mode (UUS1 only)

Youcanprogramyourtelephoneforexternalor internalUUS1 textmessage reception. Receptionof exter nal and internal text messages can be inhibited separately. You can program the telephone directory in such a way that specific text messages can be received.

>ss>s

Messages UUS Incoming

Messages / UUS {

Incoming

Inhibit reception

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

If you have disabled reception, external or internal text messages can only be received when the sender’s phone number has been stored in the phone book with a special call signal.

Begin as follows:

Telephone operation

s Press the »External«or»Internal«

softkey toenable orinhibit receptionof UUS1 messages. FOR EXAMPLE.: »external«: .Reception of external mes sages inhibited. »internal«: Reception of internal mes sages is possible.

Error when sending or receiving an SMS

Error while sending an SMS

A correspondingerror codeis displayedin theeventthat forsome unseenreason itis notpossibleto trans mitan SMS. Contact theSMS Servicecenter ofyour networkservice provider/ carrierto findout whicher ror codes are displayed.

Error while receiving an SMS

> s s>s

Message UUS Inhib.

receiv.

Inhib. receiv. / UUS

external

internal

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Theremay bevariousreasonsforit notbeingpossibleto receiveanSMS, orforonly havingvoiceoutput:

The featureSMS has not beenapplied for (and approved)at your network serviceprovider and/or

•

theproviderof theSMS ServiceCenter. The SMShas been transferred byoutside service providerswhich didnot transmit this messageas

•

anSMS. Permanentnumber suppression(inhibit) isactivated foryour ISDNconnection.

•

Ten SMS messages have already been stored in yourtelephone, preventing any further SMS mes-

•

sagesfrombeingreceived.

Silent signalling

If youdo not wish callsto be signaledwith theprogrammed ringer melodyand volume,you canactive the »Silent signalling« feature. Depending on the specific setting, all calls will be displayed optically or along with abrief acoustic signal. To setthe volumefor thebrief acoustic signal,proceed asdescribed onpage45 or »R« in the display shows that the function »Station guarding« is activated.

»No« The function »Station guarding« is deactivated. »ok« Calls are signaled optically only (»Q« shown in the display). »Ringing signal off« Calls are signaled first by abrief acoustic signal andthen only optically

(»q«).

Only for msn-1 The functions describedabove are configured onlyfor MSN-1. This as

Quiet No / Ringing signal 0ff/ ok

sumesthat severalMSNshave beenconfiguredinthe systemtelephone.

Monitoring costs

You have the optionof logging theaccrued communication costs for yourtelephone. You must apply for this feature to your network service provider.

Ask your service provider on the possibilities ofcharge data transmission. Please note that transfer of all cost information fromthe exchange office toyour telephone maynot always be possiblefor technical rea sons. Any price reductionsand special rates orconvenience features utilized mayresult in differencesbe tween the data stored in the telephone and information listed in the phone bill.

Procedures for charge rate transmission

Thereare severalstandardized proceduresfortransmitting callchargerates. Usually thesameprocedureis employed at one connection that is recognized and stored automatically for future use by the telephone.

In the event that the type of charge information transmission is not stored in the phone, »Wrong

charge type« then appears in the display.

Inthis caseyoushould deleteallcharge informationstoredin thetelephone(see also:viewing/deletingtotal costs). Recognition andsaving ofthe procedurethat is usedfor transferof costinformation isthenre-acti vated.

You can set the tariff factor and the currency while configuring your telephone with the PC.

Viewing and deleting costs

Ifyou haveimplementedPINprotection foryourphone’s configuration(seepage 75),clearingofthecharge rateaccounts isalsoPIN protected. Afterpressing thesoftkey»delete?«youthen needtoenter thePIN. You can also delete communication charges using the Professional Configurator.

Viewing/deleting costs for the last call

Begin as follows:

Thechargesfor thelast callare shown. To de lete them, press the »Delete?« softkey.

Charge

Last conn: }

0. 18 EUR

Last conn.

Total

delete?

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Viewing and deleting total costs

Begin as follows:

Monitoring costs

You can view the sum of the charges accrued for all MSN extension numbers. To delete them, press the »delete?« softkey.

Ifthe sumofthe costsis deleted,allMSN costaccounts arealsodeleted simultaneouslyand rec ognitionand savingofthe procedurethatis usedfortransfer ofcost informationisthenre-acti vated.

Viewing/deleting costs for specific extension numbers (MSN)

Begin as follows:

>s>s

>ss

Charge Total

Total: }

Last conn.

delete?

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

1. 55 EUR

Total

Charge MSN-2

You can view the sum of the charges accrued for a particular MSN extension number. In this example for »MSN-2«.

<> s

Todeletethetotal costsfor theselected exten sion number (in this example MSN-2), press the left arrow button and then the »de

lete?« softkey.

Setting the tariff factor and the currency

MSN-2:}

0. 31 EUR MSN-3

MSN-1

MSN-4

MSN-2

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

MSN-2: {}

0. 31 EUR

Last conn.

Total

delete?

Begin as follows:

Msss

Configuration Charge

Monitoring costs

»Charge« Enter thenewchargefactor andconfirmyour entrybyclicking »OK«. Thecharge fac

torlength isrestrictedto4 characters. Toentera comma,usetheasteriskkey.

»Currency« Enterthenew currencyandconfirmyourentry bypressingOK. Thecurrency nameis

restricted to6 characters. The assignmentsfor thekeypad forentering letters,digits andspecial charactersaredescribedon page12.

»delete?« All chargedatastored inthetelephoneare deleted. Recognitionandsavingofthepro

cedurethat isusedfortransfer ofcostinformation(see page46)isthenre-activated.

Programming a charge limit for an extension number

Youcan setupacharge accountfor eachnumber(MSN) thathasbeen enteredinthe telephone. Anamount intheconfiguredcurrencythat isavailable formaking callswill thenbe allocatedto thisaccount forthe de fined number (MSN). Once this amount hasbeen exhausted, only free-of-charge calls canbe directed for thisMSN extensionnumber. Whenyou haveprogrammed specificdialranges forthis telephone,callswith costs can be directed to the unrestricted numbers. If this limit is reached during an ongoing call, the call can be completed. Whenthe amountfor theaccount isincreased, or whenthe accruedcharges arecleared callswith costscan again be made.

Attention: Notall serviceproviders transfercharge rate information. Ifyou makecalls usinga serviceprovider whichdoesnot transmitchargeinformation,the chargeaccountis ineffectual.

Configurationof acharge accountfor aphone number(MSN) isdescribed belowusing MSN1as theexample

Begin as follows:

If you enter the amount available for making calls as »0«, the charge account is not activated.

Msss>s

Configura-

tion

Enter the amount that is available for this number for making calls. Confirm your entry with OK.

MSN

MSN-1 ...

MSN-10

Dial inhib. by charge

Limit/EUR>10`

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Charge

Enabling or inhibiting an extension number (MSN) for outgoing calls

Each number stored in the phone (»MSN-1«…»MSN-10«) can be enabled or inhibited separately for outbound calls. If youhave inhibitedan MSN foroutgoing calls,no outgoingcalls canbe initiatedthrough this number (e. g. MSN assignment via function key). Incoming calls can continue to be received by this number. If you attempt to setup a call using a number that hasbeen inhibited for dialing, the followingmessage is shown in the display »Inhibit. : msn«. Enablingor inhibitingof anumber foroutgoing callsis protectedby anMSN-specific PIN. You mustenter thisPIN inadvanceduring configurationofthenumber(MSN). Afterthat,you caninhibitor enabledialing of external numbers (outgoing calls) for this MSN.

Begin as follows:

Monitoring costs

>s s

inhibit

MSN-1 …

MSN-10

Specific PIN for the MSN exten

sion number

A check mark displayed next to the individual softkeys indicates the current status.

s To inhibit dialing of external numbers for a

specificMSN pressthe softkey »inhibit«. To re-enable a number (MSN) for outbound calls, press the softkey »enable«.

Communication and charge displays

The following displays are possible during a call:

Call display for phone number

(»0123456«).

Displays during an ongoing call

(»0123456«) and time (»07: 41«).

inhibit

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

0123456

show

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

0123456 07:41 MSN-1

show

MSN-1?

enable

MSN-1

Memo

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Displays during an ongoing call (»0123456«) and duration (»32. 43«) of the call. For example,

0123456

32.43 MSN-1

theduration ofa callcan bedisplayed for allincoming connectionsor when there are no charge data available.

show

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Displays during an ongoing call

(»0123456«) and charges (»0. 36 EUR«).

0123456

0.36 EUR MSN-1

show

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Call display for date (»29. 05. 06«) and time (»07: 41«).

29.05.06 } 07:41 MSN-1

show

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Correct charge display is shownonly if you haveapplied at your network service providerfor transmission of charges during calls.

Memo

Monitoring costs

Displaying information during a call

Thedisplays duringcallsdescribed belowdependon yourindividualsettingsandcan therefore be different for each connection. Correct charge display is shown only if you have applied at your network service provider for transmission of charges during calls.

During a call, the upper rows of the display show the number or the name of the other party (»TONY«) and the duration of the en tire call (»02. 43«). Press the »display« softkey.

You are then shown other information avail able on the current connection. Date (»29.05.07«), Time (»07:41«), associated number (»0987654321«), Costs(»0. 36 EUR«),durationof thecall

(»02. 55«)

BEATRICE }

02.43 MSN-1

show

Mute

TONY

to MSN-1

29.05.07 07:41 0987654321 0,36 EUR 02.55

<> Pressthearrow keytodisplayfurtherinformation (ifavailable).

If you are the destination of call rerouting, you will be shown the number that is beingrerouted(»U{123«),when itistransferred.

You see the normal display again during a connection.

BEATRICE 03.33 } 03:33

Display

Memo

Keypad

park

memo

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

a Afterfinishingthe callyou seefor about5 sec

onds the following display.

Programming calling line identification mode (CLIP/CLIR/COLP/COLR)

Begin as follows:

»Incoming« Pressthe»Incoming«softkeytohavethenumbersdisplayedornotdisplayedatthe

»Outgoing« Pressthe»Outgoing«softkeytohavethenumbersdisplayedornotdisplayedatthe

Ms sss

Configuration Display MSN ext.

calledparty. Acheckmarkdisplayednexttothesoftkeyindicatesthatcallinglineiden tificationis active.

ªªªªªªªªªªªªªªªªªªªªªª

TONY Costs 0.36 EUR

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Monitoring costs

System telephony

The system telephone is designed for being connected to the internal ISDN connection ofpabx systems.

Whenoperated atthesepabxsystems,your telephoneoffersyouavariety oftypicalfeatures. Forexample:

Dialingfrom thepabx telephonedirectory (seepage 19).

•

Messageand Intercom(seepage24, 25).

•

Specialfunctionkeys (seepage52).

•

Accessto thesystemmenuofthepabx(seepage 57).

•

Pleaserefer tothe operatinginstructions ofyour PABXto determinewhether thesetypical sys tem features are provided with this particular telephone.

Function keys

Thesystem telephoneis equippedwithfive functionkeys, whichyou canprogramon twolevels withdiffer ent functions.

Each key isequipped with two-color LEDthat can be used to displaythe active function. Each color is as signed to a particular level for the function key.

Function key examples

Direct dialing buttons (see page 19)

DTMF/ keypad sequences (see page 28)

Defining the MSN extension number for the next call (MSN assignment)

You can conduct an internal or external call such that a defined number (MSN) is transferred from your telephoneto thepartyyouarecalling. Thisnumber musthavebeenentered previouslyinyour telephone.

Line keys

A B channel for an external ISDN connection is configured for a line key. When this key is pressed, hands-freecalling isactivatedautomatically andthe correspondingBchannel oftheISDN connectionisac cessed. You will hear the external dial tone. If an external call issignaled at a different in-housetelephone you can accept thiscall by pressing the line key.

Trunk group buttons

If several ISDN ports can be compiled to form trunk groups you canassign them to one trunk group key. When thiskey ispressed, hands-freecalling is activatedautomatically and thecorresponding Bchannel of the ISDN trunk group is accessed. You will hear the external dial tone.

Extension keys

You canconfigure dialing toan internalextension usingan extensionkey. When the correspondingkey is pressed hands-free calling is activated and the listed subscriber called. If a call for the listed subscriber is signaled you can accept the call by pressing the extension key. Waitingcalls areindicatedby flickeringoftheline keyLED.The callcanbepickedup byanymemberwithin the group just by pressing the key.

System telephony

Connection keys

Functionkeysat thesystemtelephoneor expansioncan beconfigured inaddition tothe softkeys »Call1.. « for executing broker‘s calls. In this case, two to four of these keys must be configured.

Nootherkeys maybeconfiguredbetweenconnection keys.

• Thenumber ofpossibleconnections dependson thenumberof connectionkeysthat areconfigured.

• If fewerthan four (4)keys are configured,the functionsCall waiting andInquiry call areonly avail ableina limitedscope.

Ifseveralconnectionsare»Idle«,thecallsignaledfirstispicked upwhenthehandsetislifted.

• If severalconnection keys areavailable, the corresponding connectionkey can be usedto select the

• call to be picked up when several calls are waiting. Note here however that only one ISDN system telephoneshould beoperated atthe ISDNport, and thatonly simplecall waitingis configured.Only thenis itpossibletogive preferencetoasecond waitingcalloveran ongoingcall(bothcallers require oneBchanneleach).

Ifa callis nowsignaled, afurther connectioncan besetupwithoutliftingthe handsetusing afurther

• connectionkey.

Broker’scalls canbeexecutedusingtheconnection keys.

• Allocationof aconnection, orof acall, isretained untilthe callor connectionis ended,incontrast to

• thesoftkeys »Connection1..«.

• A connectioncan beset upusing aconnection keyand thenpressing aline key.

• During anongoing callit ispossible toset upa furtherconnection bypressing theconnection key.

• Pressing the terminating key discontinues thecurrent connection and the connection withthe last callthat wason hold.

• If you wishto connectan ongoingcall withone that ison holdyou mustclick the softkey»Transfer« andthenpresstheconnectionkeyfor thecallthat ison hold.

»System-parked inquiry« button

Thecalled subscriberusesthe system-parkedinquiriycall featuretodial thedefaultnumericcode. Thetelephoneis nowavailablefor otheruses,for exampleanannouncementormessage. Adifferent subscribercan accept the call whenhe/she lifts the handset and dialsthe corresponding number for the callon hold. The code numbersgiven bythe PABXsystem can alsobe entered inthe functionkeys forone or severalsystem telephones.If acall isplaced inthe Parkedinquiry queueby pressinga functionkey, thisis indicatedby the LEDs of the function keys flashing at the system telephones configured for this feature. The call can be picked upby pressingthe correspondingfunction key. Thisperformance featureis possiblewhen onlyone call is on hold.

Team keys

Ateamkey isa normalline keyto whichthe internalnumberfor ateam isassigned. When thecorrespond ing key is pressed hands-free calling is activated and the listed team called.

If a call for the listed team is signaled you can accept the call by pressing the team key.

Team log-on/off

If youare entered asa subscriber inthe callswitching modes ofone or moreteams you canconfigure akey so as tocontrol the callsignaling of your telephone. When you arelogged in, team calls willbe signaled at your telephone. No team calls are signaled at your phone if you are not logged in.

System telephony

Day/ Night modes

You can configurea key so that youcan switch betweenthe call switching modesof the PABX (Day/Night modes)when thatkeyispressed. The pabxuses call modesfor signalingteamor doorterminalcalls, forex ample.

Announcement (see page 24)

Message enable on/off

You can also explicitly inhibit or enable receiving of messages using a corresponding function key.

Intercom (see page 25)

Intercom enable on/off

You can also explicitly inhibit or enable receiving of intercom calls using a corresponding function key.

Boss/Sec.-function

This functionenables the interactionbetween the phonesof the secretary andthe boss. Here, aspecial ex tensionkeywiththenumber ofthe bossphone isassigned tothe secretaryphone, andone withthe number of the secretary phone assigned to the boss phone.

Xfer secretary

In conjunction witha configured »Boss key«you can use this key to determinewhether calls are to be put through directly to the boss, or whether they are to be signaled in the secretary’s office.

Call filter

Thecall filterallowsyou toexplicitlyreject orforwardcalls toyoursystem telephone. Arejected callisgiven abusy signaland isstored inthe callerlistwith aspecial flag. You canconfigure thecall filterusingPC Configuration for the system telephone and activate or de-activate the filter using this function key.

Call rerouting

You canconfigure abutton suchthat call reroutingis setup for aspecific extensionnumber (MSN)of your phone. Press this button to activate or deactive call forwarding (see page 66).

Direct dial-in

Directdial-in fromthe telephonecanbeconfiguredvia programmedfunction keys.The directcall number mustbe storedinthetelephone beforedirectcalling viaa functionkeycan beprogrammed. Deactivationof direct calls is carried out as described in the section »Direct call« (see page 66).

Headset on/off

If you have aheadset connected to your telephone and readyconfigured, you can operate it by meansof a function key. In the factory default setting, buttons 4(headset) and 5 (auto-answer) areprogrammed for this. Press the headset key to initiate, accept or end a call.

Auto-Answer

Your telephone can accept calls automatically, without you having to lift the handset or press the speakerecall flash button. The time interval, after whicha call is automatically answered,is programmed

System telephony

during telephone configuration with the PC. The auto-answer feature is activated and deactivated by means of dedicated function key.

Extension key for an answering machine

This keyis aspecial linekey to whichthe internalnumber forthe answeringmachine isassigned. A DTMF sequence can also be assigned to this key. When you press this key the number of the answering machine is dialed and the stored DTMF sequence thentransmitted. 0000, MSNenabled fordialing Whentheanswering machineis calledthe speakeris acti vated, but themicrophone remains switchedoff. You can also accept acall signaled at the answeringma chine by pressing this key.

Voice Mail-Button

Ifyou areusing avoicemailsystem atthe PABXtowhichyour phoneis connected(forinstance aDiscofone voicemail system)you canalsoconfigurea buttonfor controllingvoicemail functions. You canthen setup a connection to your voice mail box by pressing this button.

User on/off button (sertaste ein/aus (programming the system telephone’s MSN extension number)

Normally, thefirst number enteredin thetelephone (MSN-1) is usedas the defaultnumber for all settings andactions. Youcanset thedefault numberforyourtelephoneusing theUserecall flashbutton. Whenyou pressthiskeythedefaultnumberfor thetelephone ischanged tothe correspondingphone number(MSN). Thechangeddefaultnumber isthenusedwhen youinitiatea callandwhenyousend SMSorUUSmessages.

Status info button Status info / record

This button can be configured as »Router button« (code 01) or »Recording button« (code 02).

Router button (01)

Ifyou haveconfigured astatus informationkey youcan terminateongoingInternet connectionsand setup newones usingthe providerenteredinthe configurationdata atthe clickofabutton.The functionkey LED indicates the status of an Internet connection (LED off: No connection, LED on: Connection via WAN).

Recording button (02)

(Onlyif thisfunction issupported bythe PABXsystem)Whenyou pressthe Logkey duringan ongoingcall, the log function is then activated (LED lights up).

Macro functions

You can configure theexisting function keys ofyour telephone as self-programmed function keys. These self-programmedfunctions arecalledmacro functions(macros). Macros allowyouto savesetroutines and assignthemto aspecific functionkey. For example,you cansave frequentlyused codesfor yourPABX sys temor specifcroutineactions asamacro andcallit upata latertimeby pressingthecorresponding function key.

System telephony

LED functions

Function key / LED lit flashes flickers

Line key

Chef-sec-Tasten

Xfer secretary Calls are rerouted from the boss

System parked inquiriy Conversation held in a sys

Extension key Connection Connection on hold Incoming call / Call waiting

Team key Incoming call

Trunk group button no B-channel available Incoming call

Extension key AM Connection with AM/ Voice

Voice Mail key New messages available

Function key / LED lit not lit

MSN assignment connection established by means of the

Team function log-on/log-off logged in logged out

Day/ night mode Night active day active

Announcement own message

Message enable on/off enabled inhibited

Intercom own intercom

intercom enable on/off enabled inhibited

Call filter active off

Call rerouting active not active

Direct dial-in active not active

Headset on/off Connection or

Status info button (01) Connection active no WAN connection

Auto-Answer active not active

Userecall flash button modified number default number

Connection Connection on hold Incoming call

phone to the secretary.

Incoming answering machine

no connection

Box

key

connection establishment

tem-parked inquiry

AM holds active connection

with caller

call

Function key /

lit flashes flickers not lit

LED

Connection keys Existing connection Connection being put on

Each function key with automatic LED functions(e. g. extension keys, line keys) may only be programmed one time for each system (telephone and key expansion module).

Programming a function key

Programming of the function keys is effected during configuration of the system telephone with the PC. You can program the five function keys on two levels with different functions.

hold

Call status No connection

System telephony

Using the function key

Press the corresponding function key. The function assigned to this key is executed. An LED associated with this particular function is switched on or off accordingly.

Press thekey twotimes to reachthe secondlevel forthe functionkeys. This mustbe executedat ashort in terval.

Important notes for LED functions

The status ofthe LEDs is notupdated permanently in the systemtelephone. The status of the LEDs isnot changed whenthese functionsare changedor switched usinga codeor PCconfiguration for thePABX sys tem. If the telephone isdisconnected from theISDN network (for example for Parkingof a call) the LEDs will be off when the system telephone is plugged in again. The display for the assigned LED is changed and the corresponding feature activated/de-activated in the PABX system when you press a function key.

Example: You activate the message to your system telephone using the function key and someone else de-activates the announcement viathe PABX system PC configuration. When you press the functionkey you also de-activate the message and the assigned LED is switched accordingly.

System menu at a pabx with system telephony

The system telephone is designed for being connected to the internal ISDN connection ofpabx systems. These devices provide a special menu with further system-specific functions. This menu and the features that it contains are managed entirely in the PABX.

Simply press the »PABX menu« softkey to access the system menu.

Accessing the system menu for PABX systems

> The telephone is idle. Press the right arrow

key.

29.05.07 07:41

Info

Tel. drctry

VIP

s Press the »PABX« softkey. 29.05.07 07:41

inhibit

unpark

PABX

The descriptionof themenu andthe features whichare availableto you inthis menu aregiven in the operating instructions for your PABX system.

Quiet

Caller list

Memo

Charge

Message

System telephony

Configuring and setting up the system telephone

Extended configuration

For a full configuration the following options are available:

PC-configurationusingthe telephone’sUSB-port

•

Configurationusingthe internalISDN portofaPABX.

•

Extended configuration directly at the phoneYou must enter a code before you can access the ex

•

tendedconfigurationmode.

Only limited configuration is possiblewhen the telephone isrecognized as a system telephone whencon nected to an System PABX system. You have to enter a specific code number in order to enter the tele phone’s extended configuration mode.

If thetelephone isnot recognizedas asystem telephone(for examplewhenconnected tothe NTBAor atan internalISDN portof aPABX systemthat isnot partof thesystem), theextended configurationis activated automatically.In thiscaseyou donothave toinputthe activationordeactivation codesforextendedconfig uration.

Activating the extended configuration mode

Enter the code »**46 782 551 ##« (Vanity format »**INSTALL1##«).

Release for remote access of the phone is effected for 30 minutes.

Deactivating the extended configuration mode

Enter the code »**46 782 550 ##« (Vanity format »**INSTALL0##«).

If theISDN telephoneis disconnected from theISDN network, (for exampleby unplugging theISDN connectorof thephoneor byswitchingofforresetting thepabx),theextendedconfiguration modewillbeautomatically switched off.

In the configuration described inthe following, performance features and functionsthat can be onlyentirely or partiallyconfigured using »Extendedconfiguration« are shownunderlined in the display shots.

Example:

s The display shows the performance feature

»Direct dialing«, that can only be configured with »Extendedconfiguration« or using the »Professional Configurator«. In the “normalconfiguration” thisperformance fea ture is not shown in the display.

Program tnumbs

Tel. drctry

VIP

direct

Configuring and setting up the system telephone

Acoustic

headset

Ifa specialsupport featureisstoredinyour telephonefor theheadsetyour areusing, setyourphonefor that headset model. For example,the LED inthe microphoneextension for »FireflyF142 N« from Plantronicscan be activated by the telephone.

Begin as follows:

A check mark displayed next to the individual softkeys indicates the current status.

s Press theappropriate softkey toconfigure the

connected headset.

Speaker Permanent handset volume setting

Begin as follows:

Usethe arrowbuttons to set the volume. The barin thedisplayindicates thecurrentstatus. Confirm your entry with OK.

Mss

Acoustic Headset

headset / Acoustic?

PLANTRONICS FIREFLY Standard GN Netcom 2100/2200 SILICOMP

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Mss

Acoustic

Speaker {}

vol.

- ©©©−− +

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Speaker

Temporary volume setting

bg Thetelephone isidleoryou wishtochangethe speakervolumeduringan ongoingcall.

L Presstheopenlisteningbutton.

M <>

Press the menu key. Usethe arrowbuttons to setthe volumeof the speaker. The bar in the display indicates the current status.

Loudspeaker{}

vol.

- ©©©−− +

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Configuring and setting up the system telephone

E PressESCinordertoreturntothenormaldisplayduringanongoingcall. Ifyouconfirmyour

entrybypressingOKinsteadoftheESC,thepermanentlysetvalueisoverwrittenbythenewly setone.

Call waiting

Ifthe functioncallwaiting (seepage68) isenabledonyour telephoneyoucan setthevolumeof thecallwait ing signal. You can also select whether a waiting call is signaled only once, or several times.

Begin as follows:

s Thecheck marknext to»repeat« indicates

thata waitingcallwil besignaledrepeatedly. If you pressthe softkey again, awaiting call is signaled only once. The check mark next to »repeat« is deleted.

Mss

Acoustic Call wait.

Call wait. tone

Volume

repeat˜

s Pressthe»Volume«softkey.

Usethe arrowbuttons to setthe volumeof the callwaiting signal. Thebar inthedisplay indicates the current status. Confirm your entry with OK.

Call wait. tone {}

vol.

- ©©©−- +

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Acknowledgement signals

With your ISDNsystem telephone you canselect whether the acknowledgementsignals are always active, never activeor only active whenan incorrect entry ismade. The default setting hasthe acknowledgement signal always active.

Begin as follows:

A check mark displayed next to the individual softkeys indicates the current status.

s Press the softkey for the desired function:

»No«: Acknowledgement tones always off »ok«: Acknowledgement signal always ac tive.

Mss

Acoustic Ack. tones

Configuring and setting up the system telephone

»Only error tn«: Acknowledgment signal active for erroneous input.

Idle Notice tone volume for »Station guarding«

You have various options of setting your telephone to »Station guarding« (see page 45). You can setyour telephone tosignal incomingcalls by abrief acoustic signalwhile »Station guarding«is active.The volume of that idle tone is adjustable.

Begin as follows:

Mss

Usethe arrowbuttons to set the volume. The barin thedisplayindicates thecurrentstatus. Confirm your entry with OK.

Acknowledge signal

active?

Only error tn

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Acoustic Quiet

Idle tone volume {}

- ©©©−- +

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Handset Permanent handset volume setting

Begin as follows:

Mss

Acoustic Handset

Usethe arrowbuttons to set the volume. The barin thedisplayindicates thecurrentstatus. Confirm your entry with OK.

Temporary volume setting

bg Youliftthe handsetoryou areconductingacall.

Press the menu key. Usethe arrowbuttons to setthe volumeof the

Handset loudness {}

- ©©− +

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Configuring and setting up the system telephone

handset. The bar in the display indicates the current status.

Handset loudness {}

- ©©− +

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

E PressESCinordertoreturntothenormaldisplayduringanongoingcall. Ifyouconfirmyour

entrybypressingOKinsteadoftheESC,thepermanentlysetvalueisoverwrittenbythenewly setone.

Notice tone (announcement and Intercom)

You can adjust thevolume ofthe acousticsignalthat issounded atthe beginningof an announcementand duringintercom calls.Thesettings youhavemade for»Intercom««apply forannouncementsand intercom calls.

Begin as follows:

Usethe arrow buttonsto set thevolume. The barin thedisplayindicates thecurrentstatus. Confirm your entry with OK.

Ms>s

Acoustic Beep tone

Notice tone } volume

------−-Intercom−-------

- ©©− +

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Announcement

Intercom

The menu items »Announcement« and »Intercom« do not relate to settings but rather to the use of these features (see page 24 /25).

Answering machine

You can set the volume of the acknowledgement tone for the answering machine.

Begin as follows:

Usethe arrowbuttons to set the volume. The barin thedisplayindicates thecurrentstatus. Confirm your entry with OK.

Ms>s

Acoustic Answering

Volume AnsMc ackn. }

ton

- ©©− +

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

machiner

Configuring and setting up the system telephone

Date Appointment reminder volume

Youcan setvariousappointments (seepage69) foryourphone forwhichan acousticandopticalsignal isis sued whenthe set dateand timeare reached. You can setthe signaling volumefor the appointmentas fol lows.

Begin as follows:

Usethe arrowbuttons to set the volume. The barin thedisplayindicates thecurrentstatus. Confirm your entry with OK.

Audio-Out Audio-Out-Features

The telephoneis equippedwith an audiooutput (Audio-Outsocket). Several acoustic telephonefunctions canbe usedin parallelwiththelocal speakervia thisoutput. You canalso connectexternalspeakers, forexample, to allow a message to be heard in the entire office.

The following features can be used with the audio output:

Ms>s

Acoustic Date

Appt. call volume{}

- ©©©-- +

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Message,Openlistening,Hands freecalling, Callingsignals.

•

Begin as follows:

s Presstheappropriate softkeyto switchthe ex

ternal output on or off. A checkmark displayed next tothesoftkey in dicates that this feature will be output through the Audio-Outport. Press the corre sponding softkey again to deactivate the au dio output. The check mark next to the softkey is deleted.

Listening to Audio-In over the speaker

When the system telephone is idle, you can listen to audio signals directly from the system telephone speaker. You can also listen to MoH announcements or Internet music in this manner if your PC is not equipped with speakers.

Ms>s

Acoustic Audio Out

Setting for using Audio Out

Message

Signaling tones

Answering machine

Hands-free calling

Speaker function

Setting the volume

Begin as follows:

Settings

< Use the arrow buttons to select the desired

volume.

M s <> s

Acoustic Audio-In

Audio-In Idle-

Volume

- ©©©−− +

Settings

Direct call

You can program a direct call for your telephone so that when you press any key (except for ESC and the menukey) aset numberwillbe dialed.If theautomaticcallfunction isactive onlyoneconnectioncan bees tablishedto theset number. If youwishtoestablisha connectionto adifferent numberyoumust firstdeactivate the direct dial-in function. An active directcall is protected bymeans of the telephone PIN(see page 74). The directcall function can then onlybe deactivated afterentering this PIN. As longas the PINis set to»0000« (default setting),you do not need to enter the PIN and can continue by pressing OK.

The following functions are possible with the automatic dial-in activated:

Automaticdialing ofthe setnumberafter liftingthehandsetof yourphone, orpressingany key(ex-

•

ceptfor ESCand theF-menu key). Acceptingcalls, provided theseare notsuppressed bythe callfilter.

•

Signalingof previouslyprogrammed appointmentreminders.

•

Further functions (e.g.: function keys, TAPI functions or headset operation) are not possible when direct dialing is activated.

Programming an automatic call number

Begin as follows:

Ms s s

Setting Direct cal MSN ext.

Enter the telephone number. In this example: »098765«. Confirm your entry with OK.

Dir. call-in number

Direct cal>098765

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Settings

If you are using yourtelephone with a PABXsystem without direct exchangeline access, first enter theline accessdigit to obtainexternal lineaccess followed bythe automaticdial-in num ber.

Activating direct call

Deactivate direct dial-in

Ms s s

Setting Direct cal ok

Direct dialingis now activated. The set direct call numberisshownon thesecondline ofthe display.

M The phone is in the idle mode with the direct

call-in feature enabled. Press the menu key.

Enter the programmed PIN (in this example: »0000«). Confirm your entry with OK.

07:41 Dir. call

098765

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

07:41 Dir. call

098765

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Input PIN please

>****_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

s Press the softkey »ok« to deactivate direct

dialing.

Call rerouting (call forwarding)

Withthis telephoneyoucanbe reached,evenifyou arenot inthevicinity ofyourphone. This isachieved by the system automatically forwarding calls to another internal or external number. Callrerouting canbe configuredseparatelyfor anyof theenterednumbers (MSN). To utilizethecall rerou ting function you must have already configured at least one phone number.

The following settings are possible for all MSN extension numbers.

»delayed« Delayed callforwarding:

Allcalls forthis numberaresignaled foradefined timeatthe exchangeorin thePABX andare thenforwardedwhenthis periodexpires.

»busy« Callforwarding onbusy:

Thecalls foradefinednumber areforwardedonlywhen thetelephoneisbusy. (FOREXAMPLE.: Thereare alreadytwo(2)connectionsmade,or oneconnection has beenmadeand callwaitingis notpermitted)

End direct call-in?

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Settings

»Fixed« Directcallforwarding:

Allcallsforanumberforwhich„fixed“callreroutinghasbeenconfiguredarererouted. Yourtelephonewillnotring,whenthisnumberiscalled.

Youcanconfiguresimultaneous delayedcall reroutingand callrerouting onbusy. If youhave configureda set call rerouting, cancel this function before configuring a new (other) call rerouting function.

If you operate your telephone with a pabx, please observe thecall rerouting information (call forwarding) given in the operating instructions for your pabx. Ifyour isdirectly connectedtothe networktermination unit,pleaseobserve thecorresponding information supplied by the service provider.

Activate call forwarding

The following example describes how to set up MSN 1 for permanent call forwarding.

Begin as follows:

t Enter the number to which the calls are to be

forwarded. In this example: »0123456789«.

O Confirm your entry with OK.

Call rerouting has been registered. The three dotsat theright lowercornerflash alternately.

Viewing current call forwarding

When thetelephone isidle, a »U« onthe second lineindicates that Callrerouting hasbeen activated. Press the»Info«softkeyif youwishto havemoreinformationdisplayed fortheprogrammed callrerouting.

Deactivating call rerouting

The following example describes how to set up MSN 1 for permanent call forwarding.

Mssss

Setting Call

rerout.

Call forwarding direct

MSN-1>0123456789_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Call forwarding direct

msn-1}0123456789 ...

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Fixed MSN-1

Special features for the Swiss version

Inthedefault settingthe telephoneis designedfor beingoperated atthe internalISDN portof apabx. Ifyou wishto useyour telephoneat thenetwork terminationunit orat athird-party pabx,youwillhaveto change the call rerouting protocol (»Keypad« or »ETSI«) as described below.

Use at a point-to-multipoint connection (network termination unit)

Ms s sss

Setting Call rerout. Off Fixed MSN-1

Mss

Configu

ration

Service

Telephone PIN

O>ss

Swiss_

Var

keypad

Settings

Use with a PABX

Call waiting

If,during anongoingcall, asecondcall comesinfor you,thesecondcall issignaledwhen »Callwait.protect. on« is set. A caller will hear the busy signal, when you have set your telephone to »Call waiting off«. A waitingcall isindicated by abrief acousticsignal inthe speakerand alsodisplayed. You can setthe volu meof thecall waitingsignaland selectwhethera waitingcall istobe signaledonly onetime,or severaltimes (see page 61).

Whenthe function»Silent signalling« isactivated, call signallingiscarried outas describedfor thisfeature. If youare using thehands-free option for anactive connection, waitingcalls will onlybe signaled optically in the display.

The following entries are possible for the call waiting feature:

Begin as follows:

Ms s

Configu

ration

Service

Mss

Telephone

s Press the appropriate softkey below the desi-

redcallwaiting type.Thecheck marknext toa softkey indicates which setting is currently activated for selection in the first line. When there are various settings possible,first select the variant frm the first line and then the function from the lower lines. Repeat these steps until all variants are set.

O>s s

Swiss_

Var

Setting Call wait.

Call waiting

enable?

--internal=external-No

OK,extended

ETSI

s internal, external,

s No:

s ok:

s OK, extended:

internal = external

You can select thesettings to be used for callwaiting; internal only,ex ternal only, or internal and external.

With anongoing connectionor while aconnection isbeing established, no further calls will be signaled.

line Call waiting from only one subscriber is possible when:\line Only one ortwo active connectionsand no callwaiting connectionis present at your phone.

Up to 4 simultaneous connections are possible on your telephone. For example,two further calls canalso be signaledby call waitingwhile two other calls are already in progress.

Display contrast

You can set individual contrast levels.

Begin as follows:

Settings

Mss

Setting Contrast

Display contrast {}

Use the arrow buttons to set the contrast. Confirm your entry with OK.

- ©©©©--- +

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Appointment

You have the option of setting three different appointments with your telephone:

Theset appointmentis signaleddaily.

•

Theset appointmentis signaledonce.

•

Theappointment issignaled weeklyat thepreset dateandtime.

•

Once the date andtime of the set appointmentare reached, an acoustic (with fixed tune and volume)and opticalsignalis issued. Thevolume ofthe signalusedtoindicatean appointmentcan beadjusted individually (seepage 63). You can storea text for eachappointment (42 charactersmax. )which will bedisplayed when the appointment is reached.

If you press ESC, signaling of the appointment is interrupted and thencontinued later as a reminder. To terminatesignaling ofan appointmentpressOK. Signalingof theappointment canalso occurduringacall, or when you have set the »Station guarding« feature. When the telephone is idle, a »T« on the info line indicates that an appointment has been set up.

Programming an date reminder

The following example describes how to program a weekly appointment 1.

Begin as follows:

Mss<>Os

Setting Date

Enter the time of the appointment. In this example: »0930«. Confirm your entry with OK.

Enter the date of the appointment. In this example:»030603«. Confirm your entry with OK.

Select appoint

ment

Set appointment 1

Time>09: 30

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Set appointment 1

Date>03. 06. 03

Weekly

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Settings

If you wish to only change the information text for an existing appointment, select that ap pointment using the arrow keys and then click the menu key.

Deactivating an appointment reminder

Auto-Answer

Your telephone can accept callsautomatically, without you having to liftthe handset or press the speaker (headset) key. The auto-answer feature can be switched on or off with a function key that has been pro grammed for this purpose.

Enter an information text for appointment 1 (42 characters max). In thisexample: »Telephone project

meeting«.

Confirm your entry with OK.

Set appointment 1

Explanation for appoi1 Telephone project Telephone

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Mss<>Os

Setting Date

Select appoint

ment

Off

Begin as follows:

A check mark displayed next to the individual softkeys indicates the current status.

s Press the appropriate softkey to set the time

after which a call is automatically answered.

Headset Automatic headset use

If you have a headset connected to your telephone, you can use it automatically for specific features.

Automatic headset use active: Thecall istakenviatheheadset whenyoupressanextension orlinekeywithautomatic acceptingofcallsac tivated. Automatic headset use not active: Thecall istakenvia theopenlistening /hands-freecalling functionswhenyou pressanextension orlinekey with automatic accepting of calls activated.

Mss

Setting AUTO accept

Time until call

accepted ?

5 seconds

immediately

10 seconds

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Begin as follows:

Ms>s

Setting Headset

A check mark displayed next to the individual softkeys indicates the current status.

Settings

s Press the appropriate softkey to activate or

deactivate automatic headset operation.

Operation

This feature requires an »Extended Configuration«. It will otherwise not be displayed.

Begin as follows:

Ms>s

Setting Operation

s Keypad / DTMF:

Default setting during a connection (Softkey »Keypad« oder »DTMF«) Select whether in theinitial settings »DTMF« or »keypad« is possible during an ongoing call;

Mute:

Hands-free dialing (softkey »Mute«) Set whether the microphoneis activated with the handset inplace (e. g. hands-free calling), or whetherit mustbe switchedon bypressing the softkey »speak«.

Use headset

automatically ?

Use variants

Mute

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Keypad

Caller list

Setting the time

Begin as follows:

Caller list:

Actuate the softkey »Caller list«. If you select »Only messages«, this ap plies to the settings »Off„ or »On«.

Enter the time and press OK to confirm. Set time

Ms>s

Setting Time

Time>07:41_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Settings

Enter the date and press OK to confirm. Set time

Date>29.05.06__

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Call filter

Thecall filterallowsspecific callstobeputthrough orrejectedon thebasisoftherecognized phonenumber.

You can enter upto five filter numbers (26 digits max.) for the call filter. Filter numberscan be local area codes orpartial or completenumbers. When youenter »****« youcan includecalls whichdo not trans mitthe number(callerID)in thecall filter.Usingthe callfilter, callswhosenumbers,or beginningnumbers concur with the filter numbers entered in the system, can be rejected or accepted.

Rejectedcallsaresaved inthecallerlistwitha specialflag. Ifthe callwas onlysignaled atyour telephonethe caller willhear thebusy signalwhen thecall isrejected by thecall filter.If you area memberof ateam, then this call will continue to be signaled at the phones of your team.

Call filter operating modes

»No« Allcalls signaled. »reject« Calls whosenumbers,orbeginningnumbersconcurwithstoredfilter numberswill be

rejected.All othercallsare signaled.

»forward« Calls whosenumbers,orbeginningnumbersconcur withstoredfilternumberswillbe

signaled.Allothercalls arenotsignaled.

» All calls« No callsaresignaled.

Programming filter numbers

Youcanconfigure anew filternumber, oruse anumberalready storedin thetelephone (redialing,telephone directory, VIP or speed dialing memory).

The following example describes how to enter a new filter number.

Begin as follows:

Programming call filter operating modes

Ms>s s<>O s

Set ting

Enter the filter number. In this example: »012345«. Confirm your entry with OK.

Filter New

Select filter number

Enter filter no.

>012345_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

New

Begin as follows:

Ms>ss

Setting Filter Incoming

A check mark displayed next to the individual softkeys indicates the current status.

Settings

s Presstheappropriate softkeyto setthe callfil

ter to the desired mode of operation.

Filter incoming

calls ?

All calls

forward

reject

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Configuration

Begin as follows:

Configuration inhibit

inhibit

Begin as follows:

The display showsyou the various configura tion possibilities. Press the desired softkey to have the next display shown.

Mss

s Actuate the softkey »Inhibit« and enter

the PIN for »Inhibit« (factory default

0000).

Configuration }

inhibit

Display

Call-Parking

Config. inhibit

Configuration

MSN

Charge

Service

filter

Outgoing

List

(password) for the telephone

Some telephone settings and operations are protected by a PIN (password).

Accessto thetelephonemenus (seepage 75)

•

Deactivate directdial-in (seepage66)

•

Remotecontrol oftheansweringmachine (optionmodule)

•

Accessto the»Service«menu (seepage 91)

•

Usethis menuto setup yourindividual PIN(0000...9999). Please writedown theentered PIN.If youforget yourPIN, youwillnotbe abletoaccess anyofthePIN-protected settings.Inthiscase pleaseaskyourspecia lized dealer or distributor.

Begin as follows:

Configuration

Attention:The PINis alsoresetto(0000)after executingthe serviceresetforrestoring theiniti al state (see page 92).

Menu Accessing a menu via the PIN:

In theseoperating instructions, accessto menus isalways described withoutthe useof aPIN. If youset the PIN protection for a specific menu, you can access this menu as described in the following example.

Begin as follows:

Enter the new PIN. In this example: »1234«. Confirm your entry with OK.

M s ss

Configuration Inhibiting

filter

Change PIN

>1234_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Msss

Configuration inhibit Menu

Protecting access to the telephone menus by a PIN

With the telephonePIN you can restrictaccess to the telephonemenus (»Configuration«,»Set-

ting«and »Program nos. «)and protectthestored chargedatafromunauthorized deletion.Before

amenu canbecalled up(e.g.menubutton and»Configuration«key),the PINmustbe enteredwhen the protection feature is active.

You canset access restrictionsseparately forthe »Configuration«, »Setting«and »Program

nos. « menus. The»inhibit« and »Service« menusare always protected by thetelephone PIN.

Access restrictions for the »Configuration« menu will also apply for deleting stored charge data.

s Press the »Configuration« softkey to

activate or deactivate the PIN protection feature.

A check mark next to »Configuration «indicates thattheaccess restrictionisactive. Press the »Configuration« softkey again to deactive the protection feature.

ªªªªªªªªªªªªªªªªªªªªª

Configuration

Setting

Program nos.

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Outgoing

This feature requires an »Extended Configuration« to show on the display.

Configuration

Here, you can determine which call control function(s) you want to configure.

Begin as follows:

Ms s s

s List:

Select »List« to enable or inhibit the num bers entered here for dialing. A checkmark shows you which list is active.

s unrestr. nos. Only:

Select »unrestr. nos. Only« if you wish to enable all unrestricted numbers for outgoing calls. If no unrestricted number ha ve beenentered, no furthercalls can bemade. Numbers specified as unrestricted have priority over restricted numbers.

List

Configuration inhibit Outgoing

inhib. outgoing

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

calls ?

unrestr. nos. Only

List

This feature requires an »Extended Configuration« to show on the display.

You can enter 7 unrestricted and 7 restricted numbers into your telephone.

Begin as follows:

<> Usethe arrowbuttonsto selectthe desiredcall

number or a free field and then confirm with »OK«.Then enterthenewnumberor deleteor edit an existing one.

Ms ss

Configuration inhibit list

Restricted/

unrestricted number

inhibit-6:

inhibit-7:0190

Free-1:01901

Free-2:

Free-3:

Display

Call number

Use»incoming«and »outgoing« tohave yourextension numberor thenumberof thecalling party presented. A checkmark shows you, which feature is currently active (in this example here: outgoing).

Configuration

Language

You can select the language of your display.

Begin as follows:

Msss

Configuration Display MSN ext.

Msss

Configuration Display Language

Press the arrow buttons to view the available languages.

Press the softkey adjacent to the desired language.The displayswitches tothechanged language immediately.

Call-Number transfer

Incoming

Outgoing

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Which Language? }

Italiano

Español

Deutsch

English

Français

Nederland

Conversation Programming communication and charge displays

Begin as follows:

Msss

Configuration Display Conversation

s Conversation:

Configuring displays during an ongoing call. The following options are available: »date+time«, »Tel.numb. only«, »Tnumb+Time«or»Tnumb+Charge«.

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Displays during an

ongoing call

Duration

Conversation

End

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Normal Display

Tel.numb. only

date+time

Tnumb+Time

Tnumb+Charge

Configuration

s Duration:

Setting the call duration display The following options for displaying the call duration are available: »Always«: The duration is the only infor mation displayed during a call. »Never«: The charges are displayed during a call. The duration of a call is not displayed. »for Charge«: Charge data, if available, are displayed. If no charge data are available, the duration is displayed instead.

s End:

Display of information after completion of a call. At thecompletion ofa call,information about that call (for example, duration, or charges accrued) can be shown in the display.

Conversation time

display ?

Always

Never

for Charge

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Info at end of call?

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Call-Parking (default setting)

Aparking codeof 55is setin theinitialstate. Youcan changethe defaultpark codeto asingle-or double-digit code.

Begin as follows:

Connection to a pabx

This feature requires an »Extended Configuration« to show on the display.

If you operate your phone with a pabx, you can make all entries required here. Begin as follows:

The initially set park code is displayed: »55«. Enter thenew parkingcode andconfirm your entry by pressing OK.

Ms > s

Mss

Configuration Call-Parking

Standard call-parking

Call-Parking>55

Configuration PABX

s Type-Id

PABX-type(softkey »Type-Id«) Type 0:The PABX systemdoes nottransmit the lineaccess digiton incomingcalls. Theline accessdigitmustbeenteredinthephone. Type1: ThePABX systemtransmitsa lineaccess digitonincoming calls.No lineaccessdigit shouldbeentered inthephone.

s Telephonedirectory:

Withthissettingyoucandefine,whetherthetelephonedirectoryofthepabxorthetelephone bookofthephoneisloaded, whenthe»telephonedirectory« buttonispressed.

s Numberlength:

Themaximumlengthfor internalnumbersthatareassigned todifferentinternalextensions within your PABX system.

Configuration

PABX

Type-Id

Tel. drctry

External line

Numb. length

Ln.Access

s Lineaccess digitfor thepabx:

Thelineaccessdigitisplacedautomaticallyinfrontofthenumberofthecallerfortheexternal calls.

s ln.access:

Directexchangelineaccess(softkey »ln.access«) Withdirect exchangeline access,you do nothave todial the lineaccess digitfor conducting outgoingcalls.

MSN (extension numbers)

Up to 10 MSN(extension numbers) can be configuredon your telephone. When youenter an MSN orex tensionnumberinyour ISDNsystemtelephoneyouare essentiallydefiningthatyourISDN systemtelepho neis calledusingthis MSNorextensionnumberwhen acallis made.Ifyou entermorethanoneMSN exten sionnumberinyour telephone,your phonewill ringeach timeone ofthese MSNextension numbersis cal led. Ifyou areusingyour telephoneonthe externalISDNport ofapabx, enteritsinternal extensionnumberinto the pabx. Please observe the instructions in the PABX manual.

Whenyou calla subscriber,you can selecta certainnumber (MSN) thatis transmittedto the subscriber(e. g. for separatecharges). If youdo not select any number,the number (MSN) that hasbeen entered first in the phone (MSN-1) is used.

How to configure an MSN (extension number) is described in the following example with »MSN-1«.

Configuration

Begin as follows:

Entering or viewing an extension number (MSN)

You can only enter the MSN extension numbers with the Professional Configurator supplied on the WIN-ToolsCD-ROM.However,youcan havethe programmednumber displayedat thephone. Theexten ded configurationallows you toenter theMSN extension numberafter havingentered acode number(see page 78).

In the »Program MSN-1« menu, press the »MSN ext. « softkey.

The programmed number is displayed. Press OK to leave this menu.

Ms s s

Configuration MSN MSN-1

Program MSN-1 }

transfer

Volume

MSN Name

Sound

MSN ext.

Program dial number

MSN-1>222

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

You can only make further settings (e. g. call signalingmelody, volume, name) if the number has already been previously configured.

Setting the melody and the volume

Youcan defineandsetaspecific melodyandits volumeforeachMSNor extensionnumberthatyouenter. If you are using the telephoneat an internal ISDN connection of certain elmeg PABX systems,you can pro gram special ringing melodies and a different volume for internal calls.

In theinitial settingof the telephone,10 differentmelodies arestored for callsignaling. These10 melodies can notbe changed.You canimport a further10 melodiesinto yourphone viaa PC.Using theSound Man agersupplied withtheWIN-ToolsCD-ROM,you canproduceyour owntuneson thePCandthen loadthese intothetelephone. Thesemelodies arethen storedin yourphone asMelody 11… 20.Ready-to-use melody profiles for downloading to your phone are located in the WIN-Tools installation directory.

If you assign a call signaling melody to anumber (MSN) that is not stored in your phone, the first permanently stored melody in your phone is then used.

Programming a melody (sound)

In the »Program MSN-1« menu press the »Sound« softkey and then the »internal«or»ex

ternal« softkey. In this example: »internal«.

Configuration

Setting the volume

In the »Program MSN-1«menu press the »Volume« softkey andthen the »internal«or»ex

ternal« softkey.

Use the arrow buttons to set the desired mel ody. The bar in the display indicates the cur rent status. Confirm your entry by pressing ok.

Use the arrow buttons to set the volume and theringermelody. Thebar inthe displayindi cates the current status. Confirm your entry by pressing ok.

ˆ Select melody {}

MSN-1,internal 3

−©−−−−−−−−−−

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Select call signal {}

MSN-1

- ©©©−− +

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Inaddition tosteady volumes,youcanalso configurecall signalingwithan increasingvolume.Whenthis is done, thevolume of theringing toneis increasedautomatically as thecall is signaled.When the increasing volume function is configured the following symbol is shown in the display »

Entering a name for an extension number

You can assign your own names (max. 8 characters) to the MSN extension numbers. On each of the buttons on the push-button set there are three or four letters of the alphabet. You can advance through the letters by pressing the appropriate button repeatedly (see page 12). If there are two consecutive letters on the same button of thepush-button set, press the right arrow button after entering the first letter and then enter the next letter.

Inthe »Program MSN-1«menupress the »MSN Name« softkey«.

Own MSN esignation

©©©©©©«

Enterthe namedesired name.Inthisexample: »private«. Confirm your entry with OK.

MSN-1>private

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Programming a default call forwarding number

If you donot wish to accepta call, youcan forward this calldirectly to adifferent phone number (seepage

20). Ifyou frequentlyforwardcalls tothesame number,youcanusethis numberasadefaultsetting inyourpho

Configuration

ne. If you then wish to forward a call, the default number will be presented first for you to use. Thedefault settingforsuchanumberismade separatelyforeach number(MSN)enteredin thetelephone.

In the »Program MSN-1« menu press the »transfer« softkey.

Programming a specific PIN for an extension number (MSN)

You canassign separatePINs toall ofyour telephone’sextension numbers(MSN). Using thisPIN, youcan enable or inhibit an extension number (MSN) for outbound calls.

In theinitial state,all MSN-specific PINsare setto »0000« Program MSN-1« menupress the right arrow button and the »PIN« softkey«.

Enter thedesired telephone number.To dele te an existing number press the C button. In this example: »0123456«. Confirm your entry with OK.

Enter the specific PIN for »MSN-1« (default setting »0000«). If you have forgotten the MSN-specific PIN, you can access this menu via the individual PIN for the telephone. Confirm your entry with OK.

Call forward. number

MSN-1>0123456_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Input PIN please

>****_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Enter the 4-digit specific PIN for MSN. In this example: »1234«. Confirm your entry with OK.

Change PIN

MSN-1>1234_

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

Setting up the IP-S400

Ifyou onlypressedthe

84), you can now complete the log-in and assign the corresponding MSN to the system telephone.

Incomplete log-inis indicated onthe title line of your system telephone display.

insteadof enteringtheMSN whenturningonyour systemtelephone(see Page

--GUEST-- 10:27 {}

Begin as follows:

Configuration

Log-on

Thefollowing inputactionsare optionalandare usedonlyfor systemsecurity– theyarenot ne cessarily required for proper functioning of the system.

Simple log-infor DHCPis describedon Page. Ifa PINhas alreadybeen givenunder »Allowconfiguration« and the »Log-in name« entered under »Subscriber name« in the »Professional Configurator«, you must now alsoenter this informationfor theIP-S400. You must enterthe MSN asthe name(only digits arepermitted). You can dothis using the»Professional Systel-Configurator« or onthe system telephoneitself. If you enter the »IPS Log-in PIN« in the system telephone first, you must also enter that information in the subsequent configuration for the PABX system.

Enter the MSN. In this example: »12«. This MSNmust alreadybe assignedas an»in ternal number«for yoursystem telephonevia the »Professional Configurator«, or assigned now.This MSNisinactive untilthesame MSN (internal number) is entered using the »Professional Configurator«.

Mssss

Configura

tion

MSN MSN-1

...

MSD10

Program MSN-1

> 12

MSN ext.

Entering the IPS Log-in PIN

Begin as follows:

Entering the »Sys-Server Log-In PIN for the IPS«

Observe the different designations when entering the PIN:

PIN name in the configuration with the system telephone:

PIN name in the configuration using the »Professional Systel-Configurator« for the system telephone:

PIN name for configuration of the subscriber the »Professional Configurator« for the PABX system:

Ms ss>s

Configuration MSN MSN-1...MSN10 IPS Log-In PIN

Enterthe phonePINunder »PIN«. Onlydigits are permitted for this PIN. In the example shown here (factory setting) »0000«. Confirm your entry by pressing OK.

Input PIN please

> 0000

Log-In PIN.

Log-in-PIN

Configuration

t Enter the»Log-in PIN«.When youpress the 0

key several timesin a row thepossible special characters that can be used are displayed, along with their current position on the key panel. Up to 4 levels are displayed each time youpress the0key. Whenyouthen pressakey

0...9 the character displayed for that particu larkey isselected.Waituntil thecursormoves forward one field before attempting to enter the next character. Only the character that is currently being entered is visible; characters that have already been entered are hidden by the asterisk symbol. Example: Press the key 0 one time and then key 6; the @ symbol is selected.

O E

• Synchronizing oftelephone andPABX system.

Confirm your entry by pressing OK. Press the

button.

Please enter

MSN-1> *@_

Please enter

1=! 2=% 3=? 4= 5=: 6=@ 7=, 8=. 9=0

Please note that logging in and synchronization may take several moments!

Ifthere isnoconnectiontothe PABXsystem(no LANlink,or thetelephonehasnotbeen logged in, »©-----/ /---‰ « will be shown in the display instead of the time.

Configuring the IP-S400 without DHCP

Simplelogging inunderDHCP isexplainedon Page.If youhavedifferent settingsinyour PABXsystemyou canenter thatdata here.Youcancall upthe dataandIP addresshere forasystemtelephone loggedinunder DHCP, or, you can change these settings if DHCP is de-activated.

Begin as follows:

Mss

Configuration TCP/IP settings

Configuration

s Press the appropriate softkey. Main TCP/IP and

Network settings

Sys-Server

DHCP Server

Gateway

Own IP-address

Netmask

s Sys Server:

If the elmeg PABX system gateway serves si multaneously as the system server you do not need to input any data here. If this is not the case you must click the Softkey »No« and then enter the system server IP address here. Gateway IP address when connecting directly to the elmeg PABX system.

s DHCP Server:

Here, you can select whether your system telephone is to be assigned its IP address automatically from the system (»On«), or whether you wish to configure this feature on your own (»Off«).

s Gateway:

If »DHCP« is not activated you must enter the network IP address here in which your system telephone is located.

Act gateway as Sys

server too (IP) ?

Use automatic IP

address setting ?

Off

IP address of

gateway

INA>192.168.1.250!

s IP address:

If you have selected »Off« under »DHCP«, you must enter the IP address for the telepho ne as given by the PABX system or by the net work in which the system telephone is located.

s Netmask:

In the setting »DHCP« the network / subnet work mask is applied to the PABX system. If »DHCP« is de-activated, you can enter the appropriate data here on your own.

Own IP address (IPS-

Phone)

INA>192.168.1.51

Subnet mask

INA>255.255.255.0

Configuration

Programming numbers

Programming function keys

Begin as follows:

s Press the corresponding softkey to select the

Mss

Program nos. direct

Program keys

desired menu.

function

macro

The »T400« menu is only available when you have connected an additional keyboard.

s function:

Function keys (softkey »function«) Firstselect afunctionkey andthen confirmby pressing OK.

function new prog <> <>

1_:.................

2_:.................

3_:.................

4_:.................

¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬

<> After that, you can select the function for the

key (extension key, line key, etc.) Depending onthe selectedfunction, furtherinput maybe required, for example, inputting the number for a line key;confirm your input bypressing OK.

Function for button 1_ ?

......Extension key

Line key........

.........MSN assignment

day/night all.......

T400

New

list

Function keys and further entries

function Displays Further entries

MSN assignment

Carrier/Provider prefix

Call filter

Call rerouting

Direct dial-in

Headset

Auto-Answer

Userecall flash button

»msn-assignment«

»Filter«

»Call rerout. «

»Direct cal«

»headset«

»Auto. Accept

on/off«

»User on/off«

Index of numbers (MSN 1. . . 9) that are to be transmit

Telephone number index (MSN1 … MSN-9) and code

number of the desired provider (for example 01033).

Index der Call number (msn-1…msn-9),

Call rerouting mode (1 - fixed, 2 - delayed, 3 - when

Telephone number index (MSN1 … MSN-9) for which

calls are automatically answered.

Telephone number index (MSN1 … MSN-9) you wish to

use for all further programmings..

ted.

busy) and

call rerouting target.

s macro:

Programming macro buttons (»macro« softkey) Please select a function key first. First enter a name for that macro (max. 20 characters. Then enter the separate macro commands. A macro’s command string is limited to 26 characters. Each commandor buttonsimula tionconsists oftwo characters.Youcanthere foreonly linkamaximumof 13commandsto gether, or, forexample, join7 commands/ key stroke simulations with a further 12 digits.

Commands and keys for macro programming

A macroconsists of variouscommands, orecallflash button strokes, thatare compiled intoone command sequence and stored undera defined direct dialing key. When this functionkey is pressed, theindividual commands contained in the macro are executed one after the other.

The following commands are available for macro programming:

»B« Initiatinga call(sameasliftingthehandset) »D« Endinga call(sameasreplacingthehandset) »ELSE« Alternativecommand,if arequiredcondition(e.g.»IFLA«or»IFLB«)is notfulfilled. »IFLA«

»IFLB«

»K« Keypadsequence;allofthefollowingcharacters/digitsaretransmittedasakeypadsequence.

»LA« DeactivateLED »LB« TheLED flashes »LE« ActivateLED »LZ« ActivateLEDfor twoseconds »n« Dummynumber.

»P« Pause(1second)in thecommandsequence(betweentwocharacters/commands) »RE« Re-establishthe phone’s idlestate.

ExecutethismacroonlywhentheLEDforthefirstlevelisoff(»IFLA«)orflashes(»IFLB«). Ifthisconditionisnotfulfilledtheprocedureisdiscontinued,or resumedafter thecommand »ELSE«(whereavailable).

If a number is entered prior to execution of a macro (or for example, dialed from the tele phone)thisnumberisusedinplaceof thedummynumberinthemacro.

Ifthereisanactiveconnectionatthisphone,executionofthismacroiscanceledatthispoint.

»SE« Activatingthespeaker(normalvolume) »SA« Activatingthespeaker(lowvolume) »T« DTMF-Sequenz:allof thefollowingcharacters/ digitsaretransferredas DTMFdialing.

»TS« Testinga connection.

Ifthereis currentlynoconnection active,or anoutgoingconnection cannot besetup(for B. subscriberbusy),execution ofthemacrois canceledatthis point.

If you wish to incorporate a telephone key into a macro, press the corresponding key during macro pro gramming (thisis indicated, forexample by »s5« in thedisplay). All keysused for operatingthe telephone during macro programming (e. g. save, change entry position, delete entry or cancel) cannot be incorpo ratedinto themacro bysimplyactuating them,butneed tobelinkedwith themacrobymeans ofthefollow ing commands.

»c« ActuationoftheC- button. »esc« ActuationoftheESC- button. »f« Actuationofthemenubutton. »« Actuationoftheleftarrow button. »ok« ActuationoftheOK button. »« Actuationoftherightarrow button. »R« Pressthe keytwotimesto reachthesecond levelforthefunction keys.

Key assignments for macro programming

Press

Button

1234567 1 2 3 4 5 6 7 8 9 0 * #

1 2Bc 3 D ELSE esc 4 IFLA IFLB 5 K LA LB LE LZ 6 menu N ok 7 P r RESASE 8TTS 9 0 * #

Macro programming examples:

Function Macro command string

(FOR EXAMPLE.: 012345 and activate LED for two seconds)

Key programmed for a particular number

Program an appointment reminder

Read new text messages (UUS1)

Inhibiting the phone for all outbound calls

»N«: Password for the telephone

(Key for level 1, activate LED)

Re-enabling the telephone for outbound calls

»N«: Password for the telephone

(key for level 2, deactivate LED)

Add an entry to the telephone directory

Activate/ de-activate the idle mode»ok« and LED display

RE,B,0,1,2,3,4,5,LZ

RE,menu,s3,s5

RE,,s6,s6,s2

RE,menu,s5,s1,N,OK,s5,s4

,LE,esc

RE,menu,s5,s1,N,OK,s5,s2

,LA,esc

RE,menu,s6,s2,s5

RE,s5,IFLA,s5,ELSE,s2

Service

Name Telephone name

Youcan assigna name(20 charactersmax.)to thetelephone toprovide itwithunique identificationwithin a PABX system. You willneed the telephone name for example forconfiguring the telephonethrough the interalISDN connectionofaconnected pabx. Thedefault nameenteredisthe telephone’sserialnumber.

Begin as follows:

SMS Number for the SMS center

Thesenumbers canbeeditedusing»Extended Configuration« only.It ispossibleto displaythe numbers and change the TX server.

With thissystem telephone youcan send andreceive SMS messages(text messages)to/from other phones in a fixed-line network or to/from mobile phones (see page 40).

However, sendingand receiving SMSmessages isonly possible, whenthis phoneis connected to specificelmeg pabx systems.Please refer tothe operating instructionsfor your PABXto determine whether SMS-features are provided with this particular telephone.

Ms s

Configuration Service

Enter a name for thetelephone (max. 20 cha racters) and confirm your entry by pressing Ok.

Device name

Name> 0000000923

Telephone PIN

Name

The number forthe SMS service provider (max. threeproviders) must bestored in thetelephone in order for youto sendand receiveSMSs withyour telephone.Messages canbe received usingany ofthe three sto redSMS servers,whereas transmittingof messagesiscarriedoutusing onlythe serveryou haveenabledfor this. Inthe initial (default)settings forthis telephone thenumber »0193010«is enteredfor the SMS center for Deutschen Telekom (German Telecom) and can be changed as described below.

Begin as follows:

Ms s

Configuration Service

Select theSMS server orenter the numberfor yourSMS serviceproviderwithoutthe lineac cess digit.

Telephone PIN

SMS

Funkwerk elmeg CS410, elmeg CS410-U, elmeg CS400xt, elmeg IP-S400 Operating Instructions Manual

Specifications and Main Features

Frequently Asked Questions

User Manual