Crosley BRT18S6GW1, BRT18S6GW0 Owner’s Manual

Page 1
Top 3_oum
Welcome ....................... 2
Safety mnstru tions ............ 3
lnstaimation =- I,o_,dc,cc,,cct_og
OptionM ice MakctTo Water Supply ..... 4 - 5
Door
Removal & Reversal ....... 6 o 9
Features at a Glance ......... 9
Temperature Controls ....... 10 _._
Looking inside .......... 11 - 12
& Energy Saving Tips ....... 13
ice Service .................... 14
Normal Operating Sounds..15
Care & Cleaning .......... 16- 17
Before You Call ............... 18
READ AND SAVE THESE INSTRUCTIONS pl, 24o_1_4os(J_n2oo_)
Page 2
Congratulations on your purchase of a new refrigerator! We are very proud of our product and we are completely committed to providing you with the best service possible. Your satisfaction is our #1 priority,
Please read this Use & Care Manual very carefulI_ it contains valuable information on how to properly maintain your new refrigerator.
We know you'll enjoy your new refrigerator and Thank You for choosing our product. We hope you consider us for future purchases.
PLEASE READ AND SAVE THESE iNSTRUCTiONS This Use & Care Manuai provides specific operating instructions
for your modek Use your refrigerator only as instructed in this manual. These instructions are not meant to cover every possible
condition and situation that may occur. Common sense and caution must be practiced when installing, operating and maintaining any appliance.
Pmease record your model and serial numbers below for future reference. This information is found on the serial
plate located inside the refrigerator compartment.
Please attach sales receipt
here Iorfuture reference,
Model Number:
Serial Number:
Purchase Date:
Please complete and marl in the Product
Registration Card included with your refrigerator,
Page 3
FORYOUR SAFETY
,, Do not store or use gasoline, or other flammable Iiquids
in the vicinity of this or any other appliance. Read product labels for warnings regarding flammability and other
hazards.
,, Do not operate the refrigerator in the presense of
explosive fumes.
,, Avoid contact with any moving parts of automatic ice
maker.
,, Remove alI staples from the carton. Staples can cause
severe cuts, and also destroy finishes if they come in contact with other appliances or furniture.
CHILD SAFETY
Destroy or recycle the carton, plastic bags, and any exterior wrapping material immediately after the refrigerator is unpacked. Children should NEVER use these items to play. Cartons covered with rugs, bedspreads, plastic sheets or stretch wrap may become airtight chambers, and can quickly
cause suffocation.
PROPERDHSPOSALOFYOURREFRHGERATOROR FREEZER
RiskofcHldentrapment
Child entrapment and suffocation are not problems of
the past. Junked or abondoned refrigerators or freezers are still dangerous - even if they will sit for "just a few days." if you are getting rid of your oId refrigerator
or freezer, please follow the instructions below to help prevent accidents.
Before you throw away your omdrefrigerator! freezer:
o Remove doors. ,, Leave shelves in place so children may not easily climb
inside.
,, Have refrigerant removed by a qualified service
technician.
Grounding type wall receptacle
any circumstances
....................................................................................................................................................iiil
ELECTRICAL INFORMATION ,, The refrigerator must be plugged into its own dedicated
115 Vomt,60 Hz., AC onmyemectric outlet. The power cord
of the appliance is equipped with a three-prong grounding
plug for your protection against electrical shock hazards. It must be piugged directly into a properly grounded three- prong receptacle. The receptacle must be installed in
accordance with Iocalcodes and ordinances. Consult a qualified electrician. Do not use an extension cord or
adapter plug.
,, If the power cord is damaged, it should be replaced by the
manufacturer, service technician or a qualified person to prevent any risk.
,, Never unplug the refrigerator by pulling on the power
cord. Always grip the plug firmly, and puII straight out from the receptacle to prevent damaging the power cord.
,, Unplug the refrigerator before cleaning and before
replacing a light bulb to avoid electrical shock.
,, Performance may be affected if the voltage varies by 10%
or more. Operating the refrigerator with insufficient power can damage the compressor. Such damage is not covered
under your warranty.
,, Do not plug the unit into an outlet controlled by a waiI
switch or pull cord to prevent the refrigerator from being turned off accidentally.
,, Avoid connecting refrigerator to a Ground Fault Interruptor
(GFI) circuit.
Power cord with 3_prong grounde :_plug
Page 4
This Use & Care Manual provides specific operating instructions for your model Use the refrigerator only as instructed in this Use & Care Manual. Before starting the
refrigerator, folmow these important first steps. LOCATION
. Choose a place that is near a grounded electrical outlet.
Do Not use an extension cord or an adapter plug.
o If possible, place the refrigerator out of direct sunlight
and away from the range, dishwasher or other heat sources.
o The refrigerator must be installed on a floor that is level
and strong enough to support a fully loaded refrigerator.
o Consider water supply availability for models equipped
with an automatic ice maker.
INSTALLATION
DOOR OPENING
Your refrigerator should be positioned to allow easy access to a counter when removing food. To make this possible, the direction in which the doors open can be reversed. See Door
Removal & Reversal Instructions.
LEVELING
All four corners of your refrigerator must rest firmly on a solid floor. Your refrigerator is equipped with adjustable front rollers or front leveling screws to help leve! your unit.
installation Clearances * Allow the following clearances for ease of installation,
proper air circulation, and plumbing and electrical connections:
Sides & Top 3/8" Back 1"
Adjustable Front Roller
(some models)
Stationary Front Roller
with Leveling Screw
(some models)
Page 5
To Connect Wate_ Supply LineTo ice Maker ln_etValve
1. Disconnect refrigerator from electric power source.
2. Place end of water supply line into sink or bucket. Turn ON water supply and flush suppIy Iine until water is clear. Turn OFF water supply at shutoff valve.
3. Unscrew pIastic cap from water valve inlet and discard cap.
4. Slide brass compression nut, then ferruIe (sIeeve) onto water supply line, as shown.
5. Push water supply line into water vaIve inIet as far as it wilI go inch). Slide ferrule (sleeve) into valve inlet and
finger tighten compression nut onto vatve. Tighten another half turn with a wrench; DO NOT over tighten.
6. With steeI clamp and screw, secure water supply Iine to rear panel of refrigerator as shown.
7. Coil excess water suppIy line (about turns) behind refrigerator as shown and arrange coils so they do not
vibrate or wear against any other surface.
8. Turn ON water supply at shutoff vaIve and tighten any connections that leak.
9. Reconnect refrigerator to electrical power source.
10. To turn ice maker on, Iower wire signa! arm (see ice maker front cover for ON/OFF position of arm).
Before lnstaHi_gTheWate_ S_pp_y Line,Yo_ Will Need
,' Basic Too_s: adjustable wrench, flat-blade screwdriver,
and Phillips TM screwdriver
,, Access to a household cold water line with water pressure
between 30 and 100 psi.
,, A water supply Iine made of ¼ inch (6.4 mm) OD, copper
tubing. To determine the length of copper tubing needed, you wilI need to measure the distance from the ice maker
inlet vaIve at the back of the refrigerator to your cold water pipe. Then add approximately 7 feet (2.1 meters), so the refrigerator can be moved out for cleaning (as shown).
,, A shutoff valve to connect the water supply Iine to your
household water system. DO NOT use a seIf-piercing type
shutoff valve.
,, A compression nut and ferrule (sleeve) for connecting the
water supply line to the ice maker inlet valve.
Page 6
_,_ TopHinge
'_ Cove(
ToolsNecessary:
DOOR REMOVAL AND REVERSAL INSTRUCTIONS:
Socket Adjustable
Wrench Set Wrench
Awl
1. Remove toe grille.
2. Remove top hinge cover. Trace around the hinge with a soft lead pencil. This makes reinstallation easier. Remove top hinge and lift door off center
hinge pin. Set door aside.
3. Unscrew center hinge pin using adjustable wrench and save for reassembly. Ensure plastic washer stays on hinge pin.
4. Lift refrigerator door off of bottom hinge and set aside.
5. Remove center hinge and shim by removing inside screw and loosening two outside screws enough to allow hinge and shim to slide out. Tighten screws.
6. Loosen two outside screws on opposite side of refrigerator, remove inside screw and install center hinge.
7. Remove two screws on bottom hinge with 3/8" socket wrench.
8. Instatl bottom hinge on opposite side with the two screws removed from step 7.
9. Unscrew bottom hinge pin using adiustable wrench. Move hinge pin to other hole in hinge and tighten with adiustable wrench.
10. Reverse door handles (see instructions on next page).
11. Move freezer and refrigerator door stops to opposite side. Before starting screws, use an awl to puncture the foam.
12. Position refrigerator door onto bottom hinge pin and screw center hinge pin
through center hinge into top of door. Close refrigerator door to help align
hinge hole.
13. Tighten center hinge pin with adiustable wrench.
14. Remove cabinet and hinge hole plugs and move to opposite side.
15. Lower freezer door onto center hinge pin.
16. Close freezer door. Have an assistant lift up on opposite side of door while
tightening screws to install top hinge.
17. Replace toe grille.
18. Plug in electrica! power cord and turn refrigerator temperature control to
center position. Adiust setting as necessary.
Page 7
TOREMOVEFREEZERHANDLE: (Handlesmaybeeasiertoreversewhiledoorsareofh)
1. Removetwoscrewsattachinghandletobottomoffreezer door.
2. Removeshorttrimpiecebyslidingtrimstraightupandoff ofhandlebracket.
3. Removescrewattachingtopofhandletodoor.
4. MagneticNameplateMode_s:Gentlyprymagnetic nameplateframefromdoor.Removenameplatefromits
frame,turnframeupsidedownandinstall_noldnandle holes.InsertmagneticnamepIateintofram_
Se_f-Adhesive NameplateModels:
Gentlypeeloff nameplatefromdoor Frame_
and reapply over old handle holes.
TO ATTACH FREEZER
HANDLE:
1. ReinstalI handle on opposite side, using
same hole as nameplate.
2. Attach handle to bottom of door.
3. Slide trim piece Nameohte straight down onto - (somemodels)
handle bracket.
TO REMOVE FREEZER HANDLE:
(Handles may be easier to reverse while doors are off.)
1. Remove two screws attaching handle to bottom of freezer door.
2. Remove button plug using edge of putty knife.
3. Remove screw on side of freezer door and remove handle,
TO ATTACH FREEZER --'Screw
HANDLE:
1, Secure side of .........................
handle to door and " replace button plug.
2. Secure handle to bottom of door.
Trim --,
Serf Adhesive
_" _ and away from base of handle.
,,r"
Handle
Scre_
(Handles may be easier to reverse while doors are off.)
1. Remove two screws attaching handle to bottom of freezer door.
2. Swing bottom of handle away from the door and slide handle straight up and off of dovetail button.
3. Remove screw and dovetail button and install on other side, using the same holes as nameplate.
4. Magnetic Nameplate Models: Use putty knife to gently pry magnetic namepIate frame from door. Remove namepIate from its frame, turn frame upside down and instalI in oId handle holes. Insert magnetic nameplate into frame.
Serf-Adhesive Nameplate Models: Use putty knife to gently peel off nameplate from door and reapply over old
handle holes.
TO ATTACH FREEZER
HANDLE: 1, Start with handle (somemodels
offset away from doon Place top of handle over dovetail
button, swing handle into an upright
position and pull downward, locking it into piace.
2. Secure bottom of
handle with two LockHandle
screws removed Screw-.LL,_ Doveta!!B_tton
earlier.
TRIM REMOVAL (FULL-LENGTHTRIM MODELS ONLY) In some models, the refrigerator door has a full length trim
piece which continues from the bottom of the handle to the bottom of the door, The top of the trim attaches to the handle
bracket (Figure 1) or fits around the base of the handle (Figure
2), An adhesive "trim lock" is positioned about halfway down,
The bottom of the trim is held in place by either an adhesive trim lock, or a trim lock with two prongs inserted into a hole on
the face of the doon TO REMOVETRIM:
1, Remove trim by gently pulling trim lock areas out and
away from door,
2, When trim is free from door, slide the trim straight down
over
Page 8
TO REMOVE REFRIGERATOR HANDLE:
(Handles may be easier to reverse while doors are off.) Figure ! Styte HandJes
1. Remove two screws attaching handle to top of refrigerator door.
2. Remove screw attaching bottom of handle to door.
3. Remove two hole piugs and hinge pin plug on top of door and install on opposite side. Use Phillips head screwdriver to remove plastic screw plug from front of door and install on opposite side
Figure 2 Style Handles 1, Remove two screws attaching handJe to top of refrigerator
door.
2. Swing top of handle away from door and slide handle down and off of dovetail button.
3. Remove screw and dovetail button and install on other side, moving hole plugs from corresponding holes to
opposite side.
TO ATTACH REFRIGERATOR HANDLE: Figure 1 Style Handles
1. Secure bottom of handle with screws.
2. Secure top of handle with screws.
Figure 2 Styte HandJes
1. Start with handle offset away from door. Place bottom of handle over dovetail button, swing handle into an upright position and pull upward, locking it into place.
2. Secure top of handle with screws.
TO REMOVE REFRIGERATOR HANDLE:
(Handles may be easier to reverse while doors are off.)
1. Remove two screws attaching handle to top of
refrigerator door.
2. Remove button plug using edge of putty knife.
3. Remove screw on side of refrigerator door and
remove handle.
4. Reverse freezer and refrigerator handles as
shown in figure 3.
TO ATTACH
REFRIGERATOR HANDLE:
1. Secure side of handle to
door and replace plug ...................
button.
2. Secure handle to top of door,
Figure 3 - Handle Reversal
Button Plu
TO ATTACH TRIM:
1. Slide both trim locks out of trim.
2. Insert new adhesive trim locks contained in your literature pack.
w
3. install trim to handle by sliding under base of handle. Carefully align trim and press down at trim lock locations.
4. Use rubbing alcohol to remove any adhesive residue from old trim lock locations.
Full
Length '
Figure 1
:_kHandme
ovel
Dovetaim
Adhesive
f
J
q
Dovetail
--TrimLocK
FulJ
Figure 2
Refrigerator Door Without Trim
Page 9
REMOVmNGSTAINLESS STEEL DOORS AND HANDLES
Stainless steel doors are not reversible. Follow these steps to remove doors.
1. Remove toe grille and top hinge cover.
2. Remove top hinge and lift freezer door off of center hinge pin. Set door aside.
3. Unscrew center hinge bin using adjustable wrench and save for reassembb,. Ensure plastic washer stays on hinge pin.
4. Lift refrigerator door off of bottom hinge and set aside.
5. Remove center hinge and shim by removing
inside screw and loosening two outside
screws enough to allow hinge to sIide out.
Remove bottom hinge. Reinsert two outside
screws in holes and tighten.
7. Reverse steps 1 - 6to reinstalI doors
To Remove Handles
1. Firmly hold freezer handle while Ioosening set screws with 3/32" allen wrench. Remove freezer handle.
2. Repeat step 1 for refrigerator door.
ShouLder Set
Screw Screw
ShouLder
i i i/! i
Typical Handle
ice Maker_
Freezer
Controt -....
Refrigerator Control _
DeJi Drawer Cover
Deli Drawer
Hatf Sheff
Wine Rack
Futt
Special Item
Mid LeveJ
Crisper
_- Freezer Light
Fixed Door Bin
.._Door Rack
Dairy Door
TaJtBottle
Retainer
Snugger
Door Bin
Fixed Door Bin
Door Rack
Crisper Drawers
-- Toe Gritte
Features may vary according to model
Page 10
COOL DOWN PERIOD
To ensure safe food storage, allow the refrigerator to operate with the doors closed for at least 8 to 12 hours before loading
it with food.
REFRIGERATOR & FREEZER CONTROLS
Freezer Control (some models)
TEMPERATURE ADJUSTMENT
o Adjust temperature gradually: move the knob in small
increments, allowing the temperature to stabilize,
* For colder temperatures, turn the knob towards Co_der= * For warmer temperatures, turn the knob towards Cold=
Turning the refrigerator controI will change temperatures in
both compartments= For example, if the refrigerator controI is
turned to a colder setting, the freezer control may have to be adjusted to a warmer setting= Turning the freezer control will
change only the freezer temperature= To maintain temperatures, a fan circulates air in the
refrigerator and freezer compartments. For good circulation,
do not block cold air vents with food items.
/
/
OR
OR
Refrigerator & Freezer Control (some models)
Refrigerator Control (some models)
TEMPERATURE ADJUSTMENT GUIDE
if Refrigerator compartment is Too Warm Turn Refrigerator Control Slightly Towards Comder=
ff Refrigerator compartment _eToo Cotd Turn Refrigerator Control Siightly Towards Cored=
ff Freezer compartment 8s Too Warm Turn Freezer Control Slightly Towards Comder=
ff Freezer compartment 8eToo Cored Turn Freezer Control Slightly Towards Cored=
* To Turn Refrigerator Off Turn Refrigerator Control To O=
10
Page 11
SHELF ADJUSTMENT
Refrigerator shelves are easily adjusted to suit individual needs. Before adjusting the shelves, remove all food.
To adjust sliding shetves:
Remove shelf by pulling forward to stop position. Lift front edge up and pull out.
Replace the shelf on any pair of rails by reversing this procedure.
Sliding Glass Shelf
Sliding Wire Shelf
To adjust cantilever shelves:
DOOR STORAGE
Door bins, shelves, and racks are provided for convenient storage of jars, bottles, and cans. Frequently used items can be quickly selected.
Some models have door racks or bins that can
accommodate ga!Ion-sized plastic drink containers and
economy-sized jars and containers. Some racks are
adjustable for maximum storage capacity.
The dairy compartment, which is warmer than the
general food storage section, is intended for short term
storage of cheese, spreads, Door Rack or butter.
ADJUSTABLE DOOR BINS
Some models have adjustable door bins that can be moved to suit individual needs.
To move door bins
1. Lift bin straight up.
2. Remove bin.
3. Place bin in desired position.
4. Lower bin onto supports until
locked in place.
Lift front
PulI shelf out.
Replace the shelf by inserting the hooks at rear of the shelf into the walI bracket. Lower the shelf into the desired slots and lock
into position.
SpiflSafe TM glass shelves (some models) catch and hold
accidental spills. In some models, the Spfi/Safe TM shelves slide out for easy access to food and for fast cleaning. The shelves slide out independently of the cantilever brackets. Just puII the
front of the shelf forward. The shelf can be extended as far as the stopper wilI allow but it is not removable from the cantilever
bracket.
edge up.
Full Width Cantilever
Glass Shelf
Cantilever Glass Shelf
Fixed and Sliding
Adjustable Door Bin
TALL BOTTLE RETAINER (SOME MODELS) The Tall Bottle Retainer keeps tall containers in the bin from
falling forward when opening or closing the refrigerator door. To install, hold the retainer at the top, and slide it over the
outside wall of the bin, as shown in the diagram. The Tal! Bottle
Retainer works best with a Bin Snugger.
Tall Bottle Retaine_ Ieft_ and Bin Snugger (right)
11
Page 12
FREEZER TmLTOUT DOOR RACK
Freezer Tilt Out Door Rack
HUMIDITY CONTROL
(SOME MODELS)
The Humidity Controi, Humidit present on some models
with crisper drawers, allows you to adjust the humidity within the crisper. This can Cris )er extend the life of fresh Control
vegetables that keep best in high humidity.
LOW
Hurnidit,
SPECIAL rrEM RACK (SOME MODELS)
SpecialUtemRacka,owsyou
Theinoovat,vedes,gnofthe
to store a six-pack of 12 ounce
drink cans, a bottle of wine, a two-liter soft drink bottle, or a carton of egg& The Special
HtemRack mounts on the left side of your refrigerator, To
install, just slide the Special
HtemRack onto any shelf as shown in the drawing,
Special item Rack
CRISPERS (SOME MODELS)
The crispers, located under
the bottom refrigerator shelf, are designed for storing fruits,
vegetables, and other fresh
produce. Wash items in clear
water and remove excess water before placing them in
the crispers, Htemswith strong odors or high moisture content
should be wrapped before storing,
Crisper Drawer
i
MODELS) Some models are equipped
with a DeIi Drawer for storage of luncheon meats, spreads,
cheeses, and other deli items,
WINE RACK (SOME MODELS)
The Wine Rack stores bottles of wine, or single two-liter
plastic bottles of juice or soda pop. To install, slide the Wine
Rack onto the shelf with the
curve facing in. To remove, slide the Wine Rack out.
HnstaIIon either side of shelf,
Dell Drawer
Wine Rack
!
i
I
I
I
12
Page 13
FOODSTORAGEmDEAS
Fresh Food Storage
,, The fresh food compartment should be kept between 34°F
and 40° F with an optimum temperature of 37° R
,, Avoid overcrowding the refrigerator shelves. This reduces
the circulation of air around the food and results in uneven cooling.
Fruits and Vegetables
,, Storage in the crisper drawers traps moisture to help
preserve the fruit and vegetable quality for longer time periods.
Meat
,, Raw meat and poultry should be wrapped securely so
leakage and contamination of other foods or surfaces does not occur.
Frozen Food Storage
,, The freezer compartment should be kept at 0° F or lower. ,, A freezer operates most efficientIy when it is at least 2/3
full.
Packaging Foods for Freezing
,, To minimize dehydration and quality deterioration, use
aluminum foil, freezer wrap, freezer bags or airtight containers. Force as much air out of the packages as
possible and seal them tightly. Trapped air can cause food to dry out, change color, and develop an off-flavor (freezer burn).
,, Wrap fresh meats and poultry with suitable freezer wrap
prior to freezing.
,, Do not refreeze meat that has completely thawed.
Loading the Freezer
,, Avoid adding too much warm food to the freezer at one
time. This overioads the freezer, slows the rate of freezing, and can raise the temperature of frozen foods.
,, Leave a space between the packages, so cold air can
circulate freely, allowing food to freeze as quickly as possible.
,, Avoid storing hard-to-freeze foods such as ice cream and
orange juice on the freezer door shelves. These foods are best stored in the freezer interior where the temperature
varies less.
ENERGY SAVING IDEAS
_, Locate the refrigerator in the coolest
part of the room, out of direct
I sunlight, and away from heating
/ ducts or registers. Do not place the
\ refrigerator next to heat-producing
appliances such as a range, oven, or dishwasher. If this is not possible,
a section of cabinetry or an added layer of insulation between the two appliances will help the refrigerator operate more efficiently.
,, Levei the refrigerator so that the doors close tightly. ,, Refer to this Use & Care Manual for the suggested
temperature control settings.
,, Periodic cleaning of the condenser will help the
refrigerator run more efficiently. See the Care and
C/eaning Chart.
,, Do not overcrowd the refrigerator or block cold air vents.
Doing so causes the refrigerator to run longer and use
more energy.
,, Cover foods and wipe containers dry before placing them
in the refrigerator. This cuts down on moisture build-up inside the unit.
,, Organize the refrigerator to reduce door openings.
Remove as many items as needed at one time and close
the door as soon as possible.
13
Page 14
ifyourrefrigeratorhasanautomaticicemaker,itwillprovidea
sufficientsupplyoficefornormaluse.Duringtheinitialstartup ofyourrefrigerator,noicewillbeproducedduringthefirst24
hoursofoperation.Airinnewplumbinglinesmaycausethe icemakertocycletwoorthreetimesbeforemakingafulltray ofice.Withnousage,itwiIItakeapproximatelyonetotwodays
tofilltheicecontainer. Newplumbingconnectionsmaycausethefirstproductionof
icecubestobediscoloredorhaveanoddflavor.Discardice madeduringthefirst24hours.
TURNINGYOUR ICE MAKER ON
After the plumbing connections have been completed, the water suppIy valve must be opened. PIace the ice container under the ice maker, pushing it as far back as possible. Lower the wire signal arm to its "down" or ON position.
TURNINGYOUR ICE MAKER OFF To stop the ice maker, Iift the
wire signal arm until it clicks and locks in the "up" or OFF position.
The ice maker also turns off automaticalIy when the ice
container is full. if your model has an adjustable freezer shelf, place the shelf in the lower position, so that the wire signal
arm will hit the ice when the container is full.
ICEMAKERTIPS
,, icecubesstoredtooIongmaydevelopanoddflavor.
Emptytheicecontainerandensurethatthewiresignal
armisinits"down"orONposition=Theicemakerwillthen
producemoreice.
,, Occasionallyshaketheicecontainertokeepice
separated=
,, Stoptheicemakerwhencleaningthefreezerandduring
vacations=
o iftheicemakerwiIIbeturnedoffforalongperiodoftime,
turnthewatersupplyvalvetoaclosedposition.
,, Wash the ice container in warm water with mild detergent.
Rinse well and dry.
,, Stop the ice maker when cleaning the freezer and during
vacations.
,, if the ice maker will be turned off for a Iong period of time,
turn the water supply valve to the closed position.
ICE PRODUCTION: WHATTO EXPECT
The ice maker wiii produce 2.5 to 3 pounds of ice every 24 hours depending on usage conditions, ice is produced at a rate of 8 cubes every 80 to 160 minutes.
14
Page 15
UNDERSTANDmNGTHESOUNDSYOUMAYHEAR
Your new high-efficiency refrigerator may make unfamiliar sounds. These are all normal sounds and soon wilI become
familiar to you. They aiso indicate your refrigerator is operating as designed. Hard surfaces, such as vinyl or wood floors, walls, and kitchen cabinets may make sounds more noticeable. Listed below are descriptions of some of the most
common sounds you may hear, and what is causing them.
A. Evaporator
The flow of refrigerant through the evaporator may create a boiling or gurgling sound.
B. Evaporator Fan
You may hear air being forced through the refrigerator by the evaporator fan.
C. Defrost Heater
During defrost cycles, water dripping onto the defrost heater may cause a hissing or sizzling sound. After
defrosting, a popping sound may occur.
D. Automatic Ice Maker
If your refrigerator is equipped with an automatic ice maker, you will hear ice cubes falling into the ice bin_
E. Cold Control & Defrost Timer or Automatic
Defrost Control
These parts can produce a snapping or clicking sound
when turning the refrigerator on and off. The timer also
produces sounds similar to an electric clock.
F. CondenserFan
If condenser coils are Iocated underneath your refrigerator as shown in the drawing at the left, you have a condenser fan. You may hear air being forced
through the condenser by the condenser fan.
G. Compressor
Modern, high-efficiency compressors operate much
faster than older models. The compressor may have a
high-pitched hum or pulsating sound.
H. Water Valve
if your refrigerator is equipped with an automatic ice maker, you will hear a buzzing sound as the water valve opens to fiII the ice maker during each cycle.
L Drain Pan (Nonremovable)
You may hear water running into the drain pan during the defrost cycle. The drain pan will be located on top
of the compressor for air-cooled condensers (black coils on back of refrigerator).
J. Condenser Coils (Fan-cooled models only)
15
Page 16
Keepyourrefrigeratorandfreezercleantopreventodorbuild-up.Wipeupanyspillsimmediatelyandcleanbothsectionsat leasttwiceayear.Neveruseanytypeofscouringpads,brushes,abrasivecleanersorstrongalkalinesolutionsonanysurface.
Donotwashanyremovablepartsinadishwasher.Always unplug the electrical power cord from the wall outlet before
cleaning.
Care
Part What To Use Tips and Precautions
Interior/Door Soap and water Use 2 tablespoons of baking soda in 1 quart of warm water. Be sure to wring Liner Baking soda and water excess water out of sponge or cloth before cleaning around controls,
Door Gaskets Soap and water Wipe gaskets with a clean soft cloth. Drawers/Bins Soap and water Do not wash any removable items (bins, drawers, etc.) in dishwasher.
Glass Shelves Soap and water Allow glass to warm to room temperature before immersing in warm water.
Tee Grille Soap and water Vacuum dust from front of toe grille. Remove toe grille Vacuum backside and
Exterior and Soap and water Do not use commercial household cleaners, ammonia, or alcohol to clean
Handles handles.
Exterior and Handles
(Stainless Steel
Models Only)
Condenser Condenser Cleaning Coils Brush is available from
(Fan-cooled your dealer. models only) Vacuum Cleaner
Condenser Coils Vacuum Cleaner
(Air-cooled models only)
Defrost Water Soap and water Some models have defrost water pan located on top of compressor at bottom Pan cloth. NOTE: The defrost water pan is NOT removable.
Exterior Soap and water (Easy Care Care Stainless Steel Models. It will remove the protective finish.
Stainless Steel Use warm soapy water to clean Easy Care surfaces. Mild liquid sprays may
Models) be used on stubborn spots.
Glass cleaner
Mild liquid sprays
Mild liquid sprays wipe with sudsy cloth or sponge. Rinse and dry.
Vacuum attachment
Soap and water
Ammonia
Stainless Steel Cleaners
Mild liquid sprays
& Cleaning Chart
light bulb or any electrical part.
CAUTION: Never use CHLORIDE to clean stainless steel.
Clean stainless steel front and handles with non-abrasive soapy water and a dishcloth. Rinse with clean water and a soft cloth. Wipe stubborn spots with an ammonia-soaked paper towel, and rinse. Use a non-abrasive stainless steel cleaner. These cleaners can be purchased at most home improvement or
major department stores. Always follow manufacturer's instructions. NOTE: Always clean, wipe and dry with the grain to prevent cross-grain scratching. Wash the rest of the cabinet with warm water and mild liquid detergent. Rinse well, and wipe dry with a clean soft cloth. No need to clean unless operating refrigerator under particularly dusty or greasy conditions, or if there is significant pet traffic in your home. If cleaning is necessary, remove toe grille and use extended vacuum attachment and condenser cleaning brush to remove dust build-up from condenser coils (see item "J" in "NORNAL OPERATING SOUNDS & SIGHTS"). Use the dusting tool attachment on your vacuum to remove dust build-up on
the condenser coils (black tubes and wires) attached to the back of air-cooled
refrigerators only.
rear of refrigerator (see illustration on next page). Wipe water pan with damp
CAUTION: DO NOT use abrasive or stainless steel cleaners on Easy
16
Page 17
NEVERCLEANCONDENSER(SOME MODELS)
If your refrigerator is equipped with a
Never Clean
condenser, there's
no need to clean the
condenser under
normal operating
conditions. If the
refrigerator is operated under
particularly dusty or greasy conditions, or
if there is significant Defrost Water Pan (some models) pet traffic in your
home, it may be necessary to periodically clean the condenser
for maximum efficiency+
REPLACINGTHE FREEZER LIGHT BULB (SOME MODELS)
1+ Unplug refrigerator. 2+ Wear gloves as protection against possible broken glass. 3+ Unsnap light shield as shown.
4. Unscrew and replace old bulb with an appliance bulb of the same wattage.
5+ Replace light shield+ 6+ Remember to plug the refrigerator back in+
Vacation and Moving Tips
Leave refrigerator operating during vacations of 3 weeks or less. Short . Vacations
Long Vacations
Use all perishable items from refrigerator compartment.
Turn automatic ice maker off and empty ice bucket, even if you will only be gone for a few days.
Remove all food and ice if you will be gone one month or more.
Turn controls to "O" ( the OFF position) and disconnect power. Turn off automatic ice maker and turn water supply valve to closed position. Clean interior thoroughly.
Leave both doors open to prevent odors and mold build-up. Block doors open if
necessary.
Freezer Light Cover Removal
Refrigerator Mid-Level Light Cover Removat
Moving
Remove all food and ice.
If using handcart, load from side.
Adjust rollers all the way up to protect them during sliding or moving.
Pad cabinet to avoid scratching surface.
17
Page 18
Common Beforecallingforservice,reviewthislist.Itmaysaveyoutimeandexpense.This
listincludescommonoccurrencesthatarenottheresultofdefectiveworkmanship
Occurrences ormaterialsinthisappliance.
Ensureplugistightlypushedintoelectricaloutlet.
Refrigeratordoesnotrun.
Check/replacefusewitha15amptime-delayfuse.Resetcircuitbreaker.
Thetemperaturecontrolisturnedto"O".
Refrigeratormaybeindefrostcycle.Wait20minutesandcheckagain.
Freezertemperaturetoocold. Refrigeratortemperatureis ° Setfreezercontroltoawarmersettinguntilfreezertemperatureissatisfactory.
satisfactory. Allow24hoursforthetemperaturetostabilize. Refrigeratortemperaturetoocold. Setrefrigeratorcontroltoawarmersetting.Allow24hoursfortemperatureto
Freezertemperatureissatisfactory, stabilize.Thencheckfreezertemperaturesandadjustasneeded.
Thecabinetisnotlevel.
Refrigerator is noisy or vibrates. Floor is weak.
See Normal Operating Sounds and Sights section.
Odors in refrigerator.
Cabinet light not working.
Automatic ice maker not working. (some models)
Interior needs to be cleaned.
Foods that produce odors should be covered or wrapped.
Replace light bulb.
Ensure plug is tightly pushed into electrical outlet.
Light switch may be stuck. Push in light switch, located on the refrigerator control box, to release.
Ensure the Wire Signal Arm is not in UP position.
Ice maker should produce 2.5 to 3 pounds of ice in a 24 hour period.
Water supply is turned off.
Water pressure is too low.
The freezer is not cold enough.
18
Loading...