Retain for Future Reference
IMPORTANT - PLEASE READ AND FOLLOW
••
Before beginning, please read these instructions completely and carefully.
• DO NOT remove permanently affixed labels, warnings, or plates from the product. This may void the warranty.
• Please observe all local and national codes and ordinances.
• Please ensure that this product is properly grounded.
The installer should leave these instructions with the consumer who should retain for local inspector’s use and for
•
future reference.
A GFI shall be used if required by NFPA-70 (National Electric Code), federal/state/local laws, or
local ordinances.
• The required use of a GFI is normally related to the location of a receptacle with respect to any
significant sources of water or moisture.
• Viking Range Corporation will NOT warranty any problems resulting from GFI outlets which are
not installed properly or do not meet the requirements below.
If the use of a GFI is required
• Of the receptacle type (breaker type or portable type NOT recommended)
• Used with permanent wiring only (temporary or portable wiring NOT recommended)
• On a dedicated circuit (no other receptacles, switches or loads in the circuit)
• Connected to a standard breaker of appropriate size (GFI breaker of the same size NOT
recommended)
• Rated for Class A (5 mA +/- 1 mA trip current) as per UL 943 standard)
• In good condition and free from any loose-fitting gaskets (if applicable in outdoor situations)
• Protected from moisture (water, steam, high humidity) as much as reasonably possible
DO NOT STORE OR USE GASOLINE OR OTHER FLAMMABLE VAPORS AND LIQUIDS IN THE VICINITY OF THIS OR
ANY OTHER APPLIANCE. THE FUMES CAN CREATE A FIRE HAZARD OR EXPLOSION.
•located so the front is not blocked to restrict incoming or discharge air flow.
•properly leveled.
•located in a well ventilated area.
•connected to the proper kind of outlet, with the correct electric supply and grounding. A 115 volt, 60 Hz, 15 amp
fused electrical supply is required.
•not used by anyone unable to operate it properly.
•used only for its intended purpose.
•properly maintained.
NNOOTTEE::
Time delay fuse or circuit breaker is recommended.
•SAVE THESE INSTRUCTIONS•
UNDERCOUNTER CABINET CUTOUT
AA
24” (61.0 cm)*
BB
Min. 34-1/2” (87.6 cm)
Max. 35-1/8” (89.2 cm)
CC
24” (61.0 cm)
*24” width for cabinet only. 24-1/4” (61.6 cm)
need for cabinet and door width clearance if
door is recessed between cabinets.
SPECIFICATIONS/DIMENSIONS
PROFESSIONAL SERIES
BBaassiiccEElleeccttrriiccDDaattaa
•115 VAC/60 Hz
•Maximum amps - 3.3
•Approximate Shipping Weight - 140 lbs. (63.2 kg)
47-1/4” (120.0 cm)
30-3/4”
(78.1 cm)
C
A
B
23-7/8” (60.6 cm)
*Optional:
*
Cutout for electrical
outlet can be
placed in adjacent
cabinetry.
Min. 34-1/4”
(87.0 cm)
Max 35”
(88.9 cm)
with leveling
legs fully
extended
PROPER DISPOSAL OF YOUR OLD REFRIGERATION PRODUCT
DANGER
SUFFOCATION HAZARD
Remove doors from your old refrigeration product. Failure to do so can
result in child entrapment, which can cause death or brain damage.
IMPORTANT: Child entrapment and suffocation are not problems of the
past. Junked or abandoned combination beverage center/ice makers are
still dangerous, even if they will sit for “just a few days.” If you are getting
rid of your combination beverage center/ice maker, please follow the
instructions below to help prevent accidents.
BEFORE YOU THROW AWAY YOUR OLD REFRIGERATION PRODUCT:
• Take off the doors.
• Leave the shelves in place so that children may not easily climb inside.
2
22” (55.9 cm)
24-3/8” (61.9 cm)
26-7/8” (68.3 cm)
3
Page 3
GENERAL INFORMATION
Figure 1
9/32”
(7 mm)
Door must be
parallel to top and
sides of refrigerator
Hinge adaptor screws Loosen these to adjust
door, on the top and
bottom of the door
Top hinge pin Remove to remove
the door
UUnnppaacckk
1. Remove banding from bottom of carton. Lift carton up and off of the unit.
2. Remove all tape and packaging material from the outside and inside of the cabinet.
. Keep all carton packaging until your unit has been thoroughly inspected and found to be in good condition.
3
AREA REQUIREMENTS
Units Certified for Indoor Use - (black outer cabinet)
MUST BE INSTALLED IN AN AREA PROTECTED FROM THE ELEMENTS, SUCH AS WIND, RAIN, WATER (SPRAY OR
DRIP).
1. Place unit so the front side will be completely unobstructed to provide proper air flow. The unit may be closed in
on the top and three sides, but the front
Installation should be such that the cabinet can be moved for servicing if necessary.
2. Unit should be in a well ventilated area. Best results are obtained at temperatures between 65°F (18°C) and 80°F
(27°C) for built-in products and 65°F (18°C) and 90°F (32°C) for freestanding products.
3. Provisions for electricity and water connection should be determined before placing unit in proper place.
Units Certified for Outdoor Use - outdoor models contain a T after the base model number (ex. VURI140T) and
have a stainless steel outer cabinet.
1. Place unit so the front side will be completely unobstructed to provide proper air flow. The unit may be closed in
on the top and three sides, but the front
Installation should be such that the cabinet can be moved for servicing if necessary.
2. Unit should be in a well ventilated area with temperature above 45°F (7.2°C) and below 110°F (43°C). Best results
are obtained at temperatures between 60°F (16°C) and 100°F (38°C).
3. Provisions for electricity and water connection should be determined before placing unit in proper place.
4. For best performance, outdoor units should be installed away from direct sunlight or under a counter or shelter.
MMUUSSTTBBEE
MMUUSSTTBBEE
unobstructed for air circulation and proper operation.
unobstructed for air circulation and proper operation.
Note: Weight of wood panel must not exceed 20 lbs.
Step 1: Verify door alignment
The door should be parallel to the sides and top of the refrigerator. If alignment is necessary the door may be
adjusted by loosening the 2 screws which secure the hinge adapter brackets to the door and adjusting the door side
to side. Use a 5/32” allen wrench for this procedure. (See Figure 1 below).
Do not lay unit on top, side, back, or front. If unit is accidentally laid in
any position other than right side up, then the unit must remain in the
upright position for at least 24 hours before plugging the unit in.
1. Four leveling legs are pre-installed in the base of the unit at the factory.
2. The unit should be leveled from front to back and side to side. If floor
conditions do not allow the unit to sit level, adjust the leg levelers by turning
the required leg leveler counter-clockwise to increase the height and clockwise
to reduce the height.
WARNING
Step 2: Remove door
Remove the top hinge pin from the hinge with an 1/8” allen wrench. Remove the door by angling the top of the door
outward and lifting the door off the bottom hinge. (See detail in Figure 1).
Step 3: Remove gasket
Lay the door on its front being careful not to scratch it. Remove the door gasket by peeling up and out of the channel.
Step 4: Cut overlay panel
Depending on the refrigerator model cut the overlay panel to the dimensions shown. Use Figure 2 and Table A.
Note: For the door closer to work properly, it is necessary to maintain a minimum space of 9/32” (7mm) between the
door and cabinet flange as shown. This space can be adjusted by adjusting the top and bottom hinge adapters.
Set the overlay panel on the door front, align the edges, and clamp together. Clamp the panel firmly but be careful
not to crush the foam in the door or scratch the door.
With the #8 wood screws provided, fasten the overlay panel to the door. (See Figure 3).
Step 8: Install door gasket
Press the door gasket into the door channel. Make certain the gasket corners are fully inserted. If applicable insert the
key into the lock and make certain the lock operates properly.
Step 9: Install the door
Install the top and bottom hinge adapter bushings back into the hinge adapters that were removed in Step 6. Install
the door by reversing the procedure from Step 2. Install the top hinge pin so the screw head is flush with the top
surface of the hinge. If applicable insert key into lock and verify the lock cam works properly with the catch bracket on
the front of the refrigerator cabinet.
Step 6: Drill holes in overlay panel
Remove the hinge adapter bushings from the top and bottom door hinge adapters. (See Figure 4). Using the holes in
the hinge adapters drill 5/16” (8 mm) diameter clearance holes into the overlay panels 3/4” (20 mm) deep. These will
be clearance holes for the top and bottom hinge pins.
Also, at this time, drill the screw pilot holes for attaching the overlay panel to the door. Select the size of the hole from
Table B. Be careful not to drill the pilot holes through the overlay panel but only 1/2” (12.7 mm) deep.
Failure to follow these instructions could result
in fire or electrical shock.
EElleeccttrriiccaallRReeqquuiirreemmeennttss
A 115 volt, 60 Hz, AC only 15 amp fused electrical supply is required. (A
time delay fuse or circuit breaker is recommended.) It is recommended
that a separate circuit, serving only this appliance, be provided.
RReeccoommmmeennddeeddGGrroouunnddiinnggMMeetthhooddss
For your personal safety, this unit must be grounded. This appliance is
equipped with a 7’ (2.1 m) power supply cord having a 3-prong grounding plug. To minimize possible shock hazard, the cord
must be plugged into a mating 3-prong grounding type wall receptacle grounded in accordance with the National Electrical
Code and local codes and ordinances. If the circuit does not have a grounding type receptacle, it is the responsibility and
obligation of the customer to exchange the existing receptacle in accordance with the National Electrical Code and applicable
local codes and ordinances. The third ground plug SHOULD NOT, under any circumstances, be cut or removed. All UL listed
combination beverage center/ice makers are equipped with this type of plug.
WATER CONNECTION
Observe and follow all local code(s) when installing appliance.
•Connect to a potable, active cold water supply line delivering water
pressure at a minimum of 20 psi and a maximum of 120 psi.
•Use 1/4” copper water tubing only and the supplied connection
fittings to connect to the water valve’s 3/4” garden hose fitting
located at the rear of the unit.
•Make certain all water connections are watertight after installation.
Form the tubing so that it will not vibrate against the cabinet body
or kink when your refrigerator is set in position.
WATER LINE LOCATION
Note: If water line is connected directly behind
the unit, allow an additional 1” clearance.
FINAL PREPARATION
1. Some stainless steel parts may have a plastic protective wrap which must be peeled off. The interior of the unit should be
washed thoroughly with hot, soapy water, rinsed and wiped dry to remove film residue and any installation dust or debris
before being used. Solutions stronger than soap and water are rarely needed.
2. All stainless steel parts should be wiped with hot soapy water. If buildup occurs, do not use steel wool, abrasive cloths,
cleaners, or powders. If it is necessary to scrape stainless steel to remove encrusted materials, soak with hot, wet cloths to
loosen the material, then use a wood or nylon scraper. Do not use a metal knife, spatula, or any other metal tool to scrape
stainless steel; scratches are almost impossible to remove.
•After making a temperature adjustment, allow at least 2 hours for your unit to reach a new temperature setting.
•The motor will start and stop often. It must do this to maintain the temperature setting.
Unplug the unit before working on anything with the electrical system.
•
Exercise caution when sweeping, vacuuming, or mopping near the front of the unit. Damage to the grill and/or the light fixture
•
witch can occur.
s
Keep the unit level for proper ice maker operation.
•
SSeettttiinnggtthheeCCoonnttrroollss
The temperature control knob is located in the grille below the door. There is a pointer on the grille at the 12:00 position to
indicate knob position. The “OFF” position will turn the refrigeration system off. Position 1 is
the warmest setting and position 7 is the coldest. Wait at least 2 hours between temperature
adjustments to find a temperature that suits you.
The ice maker must have all water drained and removed to prevent damages as
CAUTION
well as possible water damage to the surrounding area in freezing conditions.
These damages are not covered under warranty.
If the unit is move, not used for an extended period of time, or will be in an area that will be near freezing temperatures, it is
necessary to remove remaining water in the ice-making system.
The refrigerator section temperature of the unit can be adjusted using the adjusting slide
located in the left side and rear of the refrigeration section. Turn in the cold direction indicted
to make the refrigeration section colder and the opposite to warm the refrigeration section.
FOR OUTDOOR UNITS - it is recommended that in temperatures above 110°F(43°C) and
below 45°F (7.2°C) the unit be shut off. The normal operating range for the unit is between
60°F (15.6°C) and 100°F (37.7°C).
DDeeffrroossttiinngg
This unit uses an electronic control system to control both defrost and refrigeration functions. This feature eliminates the
inconvenience of manual defrosting of the evaporator in normal conditions. If commodities or ice accidentally clog the drip tray,
the obstruction must be removed for proper defrost performance. It is normal fro some water droplets to be left on the
evaporator or drip tray. These will refreeze and be removed in the next defrost cycle.
Defrosting is factory set to run after the compressor has run approximately 12 hours. For climates with high humidity levels and/or
repeated opening of the door, an optional 6-hour compressor run time is already programmed into the control. A switch will have
to be set at the control for this change to take place. (Consult your dealer or authorized service center).
A drip tray heater is located in the unit for proper removal of condensation. The heater will remain on as long as the unit is
plugged in. The control knob will not turn the heater off. Unplug or disconnect power to the unit if you are planning to leave
the unit off or unattended for extended periods of time.
IIcceeMMaakkeerrOOppeerraattiioonn
•Make certain water pressure is at least 20 psi and no more than 120 psi
and is turned on.
•The unit must be installed level for proper icemaking operation.
•The bale arm must be down in its lowest position for the icemaker to
operate.
•Make certain there are no obstructions in the fan inlet and outlet. The
fan is located beside the ice maker at the top of the freezer section.
•When the freezer section and ice maker unit has sufficiently cooled, the
ice maker will harvest ice cubes automatically.
•When the ice bucket is full, the ice maker will automatically shut off.
•You may manually stop the ice maker by raising the bale arm to the
locking position at the up most position.
IIMMPPOORRTTAANNTT::
4455°FF((77..22°CC))ffoorroouuttddoooorruunniittss,,
power supply should also be shut off and the ice bucket should be emptied and cleaned. If the ice is not used regularly,
it will clump together with time. For best results, discard ice in the bin as required and allow the ice maker to make a new
fresh batch of ice.
When operation of the appliance is to be discontinued for any length of time
the ice cube cavity in the ice maker should be emptied and dried. The water supply and
oorriifftteemmppeerraattuurreessaarreebbeellooww
Draining and removing water from the ice-making system:
1. Turn off the water supply to the ice maker.
2. Unplug the unit from the electrical outlet.
3. Disconnect the water supply fitting at the inlet of the water valve.
4. Remove the lower back panel from the rear of the unit.
5. Disconnect the water valve’s outlet water line (clear plastic line) to the icemaker unit by loosening the compression
nut on the bottom of the water valve. Drain the remaining water left in the water line trap area.
6. Reconnect the water valve outlet water line and tighten the compression nut to a watertight seal. DO NOT OVER
TIGHTEN!
7. Reinstall the unit’s lower back panel.
8. Prop the door open for air circulation to prevent mold and mildew.
9. Leave the water supply line disconnected or reconnect the supply line and leave it shut off. DO NOT turn the water
on and allow water to enter back into the water valve.
Clean the ice maker:
Cleaning the icemaker will help prevent mold and mildew growth as well as sanitize the unit for storage or when it is
put back into service. Remove all ice from the ice storage bucket and wipe dry. With an absorbent towel, wipe out
remaining water in the icemaker’s cavities as well as the outside of the icemaker unit. Refer to the label on the inside of
the freezer door for further information.
To restart the ice maker:
1. Plug the unit into an electrical outlet.
2. Reconnect or turn on the water supply line.
3. Check the water inlet for any water leaks.
4. Set the thermostat knob away from the “OFF” position by turning clockwise.
5. Make certain that the icemaker units bale bar is down.
6. Your icemaker will need several hours to reach temperature before storing commodities and accumulate ice in the
ice bucket.
INTERIOR LIGHT
WARNING
ELECTRICAL SHOCK HAZARD
Failure to disconnect the power cord when changing
the light bulb may result in electrical shock.
Never pour liquids directly onto light
assembly
CAUTION
10
11
Page 7
Screws
Light
Shield
LIGHT BULB REPLACEMENT
TROUBLESHOOTING CHART
WARNING
ELECTRICAL FIRE HAZARD
Do not replace bulb with a bulb higher than 15
watts.
This unit uses a 15-watt appliance bulb with an intermediate base located
inside the light shield. The light shield is on the back of the unit and is held in
place by the use of three screws. Remove the three screws and light shield to
remove the light bulb. DO NOT replace the bulb with a bulb higher than 15
watts.
EENNEERRGGYYSSAAVVIINNGGTTIIPPSS
•Reduce door openings.
•Close the door as soon as you can.
•Keep the condenser coils on bottom of the unit clean. (See “Cleaning and Maintenance”.)
•Adjust the temperature control to a warmer setting when practical.
•Do not put hot foods in the unit.
•Install unit away from the stove or other heat sources.
CLEANING AND MAINTENANCE
Any piece of equipment works better and lasts longer when maintained properly and kept clean.
CCoonnddeennsseerr
The condenser tubing inside the cabinet does not require frequent cleaning; however, satisfactory cooling depends on
adequate ventilation over the coils. Be sure that nothing obstructs the required air flow openings in front of the cabinet.
Spiders and insects can nest in and around the combination beverage center/ice maker causing damage to the unit.
Frequently brush or vacuum lint and dirt from the condenser coils for efficient performance by unscrewing the grill on the
bottom front of cabinet.
CCaabbiinneett
The cabinet can be washed with mild soap and water and thoroughly rinsed with clear water. Never use abrasive scouring
powders.
IInntteerriioorr
Wash interior compartment with mild soap and water. Do not use abrasive powder, solvent, polish cleaner or undiluted
detergent.
SSttaaiinnlleessssSStteeeellPPaarrttss
All stainless steel parts should be wiped regularly with hot soapy water. Use a liquid cleaner designed for stainless steel
when soapy water will not do the job.
or tomato juice to remain on stainless steel surfaces, as citric acid will permanently discolor stainless steel.
BBrraassssPPaarrttss
CCAAUUTTIIOONN::
BBRRAASSSSPPAARRTTSS..
use every day non-abrasive household cleaners.
All brass parts are coated with an epoxy coating.
All brass parts should be wiped regularly with hot soapy water. When hot soapy water will not do the job,
DDoonnoottuussee
steel wool, abrasive cloths, cleansers, or powders. Do not permit citrus
Odor in cabinetInterior needs cleaning.Clean the interior using a solution of baking
soda and war water or water and mild soap
nit operates but does not The unit has just been started and itTypical ice production is 2 lbs per day. Allow
U
produce any icehas been less than 24 hours.for the freezer section to reach temperature
and the ice maker to cycle and accumulate
ice.
Water supply is not turned on.Turn on water supply to the unit.
Inadequate water pressure to unit.Water pressure must be at a minimum 20 psi.
The ice maker bale arm is in theWhen the ice maker arm is in the uppermost
uppermost positionposition, the ice maker is off. Flip the bale
arm down to turn on the ice maker.
Freezer section has not reachedAllow the freezer section to reach
temperature.temperature.
Thermostat control knob is too warm.Turn the temperature control knob to a
higher number to allow the unit to run
colder. Allow 24 hours before readjusting
the temperature control.
Blower inlet and/or outlet is restricted. Keep blower area clear from commodities for
proper operation.
Condenser fan air flow is restricted.Make certain the grille in front of the unit is
free and open for proper air circulation.
Check and clean the condenser coil by
removing the grille in the front of the unit.
Clean the condenser with a vacuum and
brush attachment.
Room and/or water temperature is too Move the unit to an area where ambient
warm.temperature is below 90
not be placed next to a heat source such as
an oven. Check for cold water connection.
Small ice cubes Water input may require adjustmentDue to differing water pressures, the ice
maker water input may require adjusting.
Noisy operationCabinet not level;Adjust the leveling legs on the unit.
weak floor structure.The unit must be locate on a sound and
sturdy floor for proper operation.
Water line tubing vibrationAdjust the tubing as necessary to prevent
unwanted vibrations.
Ice cubes sticking together.Ice consumption is low.Use the ice in the bin frequently. Ice will
stick together if left in insulated bin over
long periods of time.
Room temperature is too warm.Move the unit to an area where temperature
is below 90oF.
o
F. The unit should
DDoooorrGGaasskkeett
The vinyl gasket may be cleaned with mild soap and water, a baking soda and water solution, or a mild scouring powder.
PPaaiinntteeddSSuurrffaacceess
Wash with warm soapy water.
which may damage the finish.
DDOONNOOTTUUSSEE
steel wool, abrasive cleansers, ammonia, acids or commercial oven cleaners
Moisture collects onHot and humid conditions.Extremely hot and humid conditions can cause
outside surface of cabinetcondensation on the outside of unit. As
humidity and/or temperature decreases,
ondensation will disappear
c
Moisture collects insideToo many door openings.Limit the amount of door openings.
of the unit.Prolonged door openingsLimit the amount of time door is open.
Hot and humid conditions.Extreme hot and humid conditions. Move unit
to a controlled environment. May consider
having the defrost section changed from 12 to
6 hours.
Defrost thermistor out of specification. Consult dealer or servicer for diagnosis.
The unit is too warm orAdjustment of the temperature Adjust the temperature control to a warmer or
too cold.control knob.colder setting and allow 24 hours before
readjusting if necessary.
Temperature control side in the Adjust temperature control slide as necessary
refrigerator section too far open.in the refrigerator section of the unit.
The unit is warm inside with Drip tray heater is on.The drip tray heater will remain energized with
the temperature control knobthe control knob in the off position. Unplug
in the “OFF” position.the unit if storing or leaving the unit for
extended periods of time.
Items on door shelf The upper two shelves of the doorTurn the temperature control knob to a lower
sometimes freeze.freeze under warm conditions.number or move the items to the refrigerator
section.
SERVICE INFORMATION
t is assumed that your combination beverage center/ice maker has been properly installed in accordance with all
I
pecifications and local codes and the appliance has been properly grounded. If your unit should fail to operate, review
s
the troubleshooting chart before calling for service.
If service is required, call your dealer or authorized service agency.
The name of the authorized service agency can be obtained from the dealer or distributor in your area.
Have the following information readily available.
• Model number
• Serial number
• Date purchased
• Name of dealer from whom purchased
Clearly describe the problem that you are having. If you are unable to obtain the name of an authorized service agency, or if you
continue to have service problems, contact Viking Range Corporation at 1-888-VIKING1 (845-4641), or write to:
VIKING RANGE CORPORATION
PREFERRED SERVICE
1803 Hwy 82W
Greenwood, Mississippi 38930 USA
Record the following information indicated below. You will need it if service is ever required. The serial number and
model number for your combination beverage center/ice maker is located on the front of the unit at the base of the
door frame.
Model NumberSerial Number
DIAGNOSTIC LED
In the back in the grille, there is a diagnostic/status LED. This LED is used to help diagnosis any problem with the unit
and to tell its status.
LLEEDDSSttaattuussCCooddee//PPrroobblleemm
Not on or blinkingUnit does not have power
Steadily blinking once per secondUnit temperature control is in the “OFF” position
Continuously onUnit is “ON” and operating correctly
2 blinks and pause; repeated patternDefrost thermistor out of range
3 blinks and pause; repeated patternEvaporator normal cycling thermistor out of range
4 blinks and pause; repeated patternControl potentiometer out of range
2 blinks, pause, 3 blinks, pause; repeated patternBoth defrost and evaporator thermistor out of range
Undercounter/freestanding combination beverage center/ice makers and all of their components and accessories, except as detailed below*, are warranted to be free from defects
n material or workmanship under normal household use for a period of one (1) year from the date of original retail purchase. Viking Range Corporation, warrantor, agrees to repair
i
*Painted and decorative items are warranted to be free from defective materials or workmanship for a period of ninety (90) days from the date of original retail purchase.
NY DEFECTS MUST BE REPORTED TO THE SELLING DEALER WITHIN NINETY (90) DAYS FROM DATE OF ORIGINAL RETAIL PURCHASE.
A
r replace, at its option, any part which fails or is found to be defective during the warranty period.
o
FFIIVVEEYYEEAARRLLIIMMIITTEEDDWWAARRRRAANNTTYY
Any sealed refrigeration system component, as listed below, is warranted to be free from defective materials or workmanship in normal household use during the second
through the fifth year from the date of original retail purchase. Viking Range Corporation, warrantor, agrees to repair or replace, at its option, any part which fails or is found
o be defective during the warranty period.
t
SSeeaalleeddRReeffrriiggeerraattiioonnSSyysstteemmCCoommppoonneennttss::
xamples are, but not limited to, bed and breakfasts, fire stations, private clubs, churches, etc. This warranty excludes all commercial locations such as restaurants,
E
food service locations and institutional food service locations.
his warranty extends to the original purchaser of the product warranted hereunder and to each transferee owner of the product during the term of the warranty.
T
This warranty shall apply to products purchased and located in the United States and Canada. Products must be purchased in the country where service is requested.
arranty labor shall be performed by an authorized Viking Range Corporation service agency or representative. Warranty shall not apply to damage resulting from abuse,
W
accident, natural disaster, loss of electrical power to the product for any reason, alteration, improper installation, improper operation or repair or service to the product by
anyone other than an authorized Viking Range Corporation service agency or representative. Warranty shall not apply to damage resulting from indoor units being used in
outdoor situations. This warranty does not apply to commercial usage.
of warranty, breach of contract, or otherwise. Some jurisdictions do not allow the exclusion or limitation of incidental or consequential damages, so the above limitation or
exclusion may not apply to you.
Owner shall be responsible for proper installation, providing normal care and maintenance, providing proof of purchase upon request, and making the appliance reasonably
accessible for service. If the product or one of its component parts contains a defect or malfunction during the warranty period, after a reasonable number of attempts by
the warrantor to remedy the defects or malfunctions, the owner is entitled to either a refund or replacement of the product or its component part or parts. Replacement of a
component part includes its free installation. Warrantor’s liability on any claim of any kind, with respect to the goods or services covered hereunder, shall in no case exceed
the price of the goods or service or part there of which gives rise to the claim.
WWAARRRRAANNTTYYSSEERRVVIICCEE::
Service will be provided during normal business hours, and labor performed at overtime or premium rates shall not be covered by this warranty. To obtain warranty service,
contact the dealer from whom the product was purchased, an authorized Viking Range Corporation service agent, or Viking Range Corporation. Provide model and serial
number and date of original purchase. For the name of your nearest authorized Viking Range Corporation service agency, call the dealer from whom the product was
purchased or Viking Range Corporation.
The return of the Owner Registration Card is not a condition of warranty coverage.
Corporation can contact you should any question of safety arise which could affect you.
Any implied warranties of merchantability and fitness applicable to the above described undercounter combination beverage center/ice maker are limited in duration to the
period of coverage of the applicable express written limited warranties set forth above. Some jurisdictions do not allow limitations on how long an implied warranty lasts, so
the above limitation may not apply to you. This warranty gives you specific rights, and you may also have other rights which may vary from jurisdiction to jurisdiction.
Under the terms of this warranty, service must be performed by a factory authorized Viking Range Corporation service agent or representative.
his warranty applies to applications where use of the product extends beyond normal residential use.
T
Retain proof of original purchase to establish warranty period.
o
o
(4.4
) the unit be shut off. The normal operating range for the unit is between 60
F
C
Warrantor is not responsible for consequential or incidental damage whether arising out of breach
You, however, should return the Owner Registration Card so that Viking Range
o
F
(15.6
o
)
F
Undercounter/freestanding combination beverage center/ice makers and all of their components and accessories, except as detailed below*, are warranted to be free from
defects in material or workmanship under normal household use for a period of two (2) years from the date of original retail purchase. Viking Range Corporation, warrantor,
agrees to repair or replace, at its option, any part which fails or is found to be defective during the warranty period
Painted and decorative items are warranted to be free from defective materials or workmanship for a period of ninety (90) days from the date of original retail purchase.
*
NY DEFECTS MUST BE REPORTED TO THE SELLING DEALER WITHIN NINETY (90) DAYS FROM DATE OF ORIGINAL RETAIL PURCHASE.
A
SSIIXXYYEEAARRFFUULLLLWWAARRRRAANNTTYY
TTWWOOYYEEAARRFFUULLLLWWAARRRRAANNTTYY
ny sealed refrigeration system component, as listed below, is warranted to be free from defective materials or workmanship in normal household use during the third
A
through the sixth year from the date of original retail purchase. Viking Range Corporation, warrantor, agrees to repair or replace, at its option, any part which fails or is found
to be defective during the warranty period.
SSeeaalleeddRReeffrriiggeerraattiioonnSSyysstteemmCCoommppoonneennttss::
Any sealed refrigeration system component, as listed above, which fails due to defective materials or workmanship in normal household use during the seventh through the
welfth year from the date of original retail purchase will be repaired or replaced, free of charge for the part itself, with the owner paying all other costs, including labor.
xamples are, but not limited to, bed and breakfasts, fire stations, private clubs, churches, etc. This warranty excludes all commercial locations such as restaurants,
E
ood service locations and institutional food service locations.
f
This warranty extends to the original purchaser of the product warranted hereunder and to each transferee owner of the product during the term of the warranty.
This warranty shall apply to products purchased and located in the United States and Canada. Products must be purchased in the country where service is requested.
Warranty labor shall be performed by an authorized Viking Range Corporation service agency or representative. Warranty shall not apply to damage resulting from abuse,
accident, natural disaster, loss of electrical power to the product for any reason, alteration, improper installation, improper operation or repair or service to the product by
anyone other than an authorized Viking Range Corporation service agency or representative. Warranty shall not apply to damage resulting from indoor units being used in
outdoor situations. This warranty does not apply to commercial usage.
warranty, breach of contract, or otherwise. Some jurisdictions do not allow the exclusion or limitation of incidental or consequential damages, so the above limitation or
exclusion may not apply to you.
Owner shall be responsible for proper installation, providing normal care and maintenance, providing proof of purchase upon request, and making the appliance reasonably
accessible for service. If the product or one of its component parts contains a defect or malfunction during the warranty period, after a reasonable number of attempts by
the warrantor to remedy the defects or malfunctions, the owner is entitled to either a refund or replacement of the product or its component part or parts. Replacement of a
component part includes its free installation. Warrantor’s liability on any claim of any kind, with respect to the goods or services covered hereunder, shall in no case exceed
the price of the goods or service or part there of which gives rise to the claim.
WWAARRRRAANNTTYYSSEERRVVIICCEE::
Service will be provided during normal business hours, and labor performed at overtime or premium rates shall not be covered by this warranty. To obtain warranty service,
contact the dealer from whom the product was purchased, an authorized Viking Range Corporation service agent, or Viking Range Corporation. Provide model and serial
number and date of original purchase. For the name of your nearest authorized Viking Range Corporation service agency, call the dealer from whom the product was
purchased or Viking Range Corporation.
The return of the Owner Registration Card is not a condition of warranty coverage.
Corporation can contact you should any question of safety arise which could affect you.
Any implied warranties of merchantability and fitness applicable to the above described undercounter combination beverage center/ice maker are limited in duration to the
period of coverage of the applicable express written limited warranties set forth above. Some jurisdictions do not allow limitations on how long an implied warranty lasts, so
the above limitation may not apply to you. This warranty gives you specific rights, and you may also have other rights which may vary from jurisdiction to jurisdiction.
Under the terms of this warranty, service must be performed by a factory authorized Viking Range Corporation service agent or representative.
IIMMPPOORRTTAANNTT::
This warranty applies to applications where use of the product extends beyond normal residential use.
Warrantor is not responsible for consequential or incidental damage whether arising out of breach of
Retain proof of original purchase to establish warranty period.
You, however, should return the Owner Registration Card so that Viking Range
Specifications subject to change without notice.
16
Specifications subject to change without notice.
17
Page 10
1918
Loading...
+ hidden pages
You need points to download manuals.
1 point = 1 manual.
You can buy points or you can get point for every manual you upload.